Pith. sign in

REVIEW 18 cited by

GLASS: Generator for Large Scale Structure

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2302.01942 v2 pith:J3ORNG4Z submitted 2023-02-03 astro-ph.CO

GLASS: Generator for Large Scale Structure

classification astro-ph.CO
keywords galaxyglasslensingmatterweakfieldsgalaxiesgenerator
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

We present GLASS, the Generator for Large Scale Structure, a new code for the simulation of galaxy surveys for cosmology, which iteratively builds a light cone with matter, galaxies, and weak gravitational lensing signals as a sequence of nested shells. This allows us to create deep and realistic simulations of galaxy surveys at high angular resolution on standard computer hardware and with low resource consumption. GLASS also introduces a new technique to generate transformations of Gaussian random fields (including lognormal) to essentially arbitrary precision, an iterative line-of-sight integration over matter shells to obtain weak lensing fields, and flexible modelling of the galaxies sector. We demonstrate that GLASS readily produces simulated data sets with per cent-level accurate two-point statistics of galaxy clustering and weak lensing, thus enabling simulation-based validation and inference that is limited only by our current knowledge of the input matter and galaxy properties.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 18 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Analytical covariances for catalogue-based pseudo-$C_\ell$s

    astro-ph.CO 2026-07 conditional novelty 7.0

    A new analytic method computes disconnected covariance matrices for catalogue-based pseudo-Cℓ power spectra by smoothing source positions and treating self-pair shot noise exactly.

  2. Joint inference of weak lensing convergence map and cosmology with diffusion models

    astro-ph.CO 2026-06 unverdicted novelty 7.0

    A transformer-based diffusion model learns the joint distribution of convergence maps and cosmology from log-normal weak lensing simulations and generates calibrated posterior samples matching MCMC results.

  3. Fourth-order galaxy-galaxy-lensing: Theoretical framework and direct estimation

    astro-ph.CO 2026-04 unverdicted novelty 7.0

    The authors derive the fourth-order galaxy-galaxy lensing 4PCF and aperture statistics, implement a numerical pipeline and FFT estimator, and detect the connected ⟨N³ M_ap⟩ signal at SNR ~9 in stage IV mock data over ...

  4. The Non-Gaussian Weak-Lensing Likelihood: A Multivariate Copula Construction and Impact on Cosmological Constraints

    astro-ph.CO 2026-04 unverdicted novelty 7.0

    Copula-constructed non-Gaussian likelihoods for weak-lensing correlations match simulations better than Gaussians on large scales, yet produce only negligible shifts in S8 for 10 000 deg² surveys.

  5. Comparing explicit likelihood and likelihood-free simulation-based inference for weak lensing cosmic shear

    astro-ph.CO 2026-07 conditional novelty 6.0

    On Euclid-like Gaussian mocks, likelihood-free inference stays well-calibrated under emulator error and non-Gaussian summaries, while explicit Gaussian-likelihood inference becomes miscalibrated and can disagree with ...

  6. A Consistent Implementation of Cluster Strong Lensing in Cosmological Simulation Light Cones

    astro-ph.CO 2026-05 unverdicted novelty 6.0

    A simulation-based procedure for cluster strong lensing that remaps uniform boxes and traces rays through resolved particles, finding uncorrelated line-of-sight structure shifts images by arcseconds and changes critic...

  7. The Non-Gaussian Weak-Lensing Likelihood: A Multivariate Copula Construction and Impact on Cosmological Constraints

    astro-ph.CO 2026-04 unverdicted novelty 6.0

    Copula-based non-Gaussian likelihoods for weak-lensing correlation functions improve large-scale agreement with simulations and can shift S8 by ~1σ on 1000 deg² surveys, with negligible shifts at stage-IV areas.

  8. Probing the Baryon Distribution with Fast Radio Bursts

    astro-ph.CO 2026-06 conditional novelty 5.0

    SKA FRB dispersion measures and their cross-correlations with Stage IV shear and clustering can pin down baryonic feedback and improve cosmological constraints by factors of ~2–5 under optimistic detection rates.

  9. UNIONS-3500 Weak Lensing: III. 2D Cosmological Constraints in Configuration Space

    astro-ph.CO 2026-05 accept novelty 5.0

    UNIONS-3500 weak lensing data yields S_8 = 0.831^{+0.067}_{-0.078} in flat LCDM from 2D cosmic shear, consistent with Planck within 1 sigma.

  10. Constraining primordial non-Gaussianity from DESI DR1 quasars and Planck PR4 CMB Lensing

    astro-ph.CO 2025-12 unverdicted novelty 5.0

    Cross-correlation of DESI DR1 quasars with Planck PR4 CMB lensing constrains local f_NL to 2^{+28}_{-34} (p=1.6) or 6^{+20}_{-24} (p=1.0), tightening previous limits by 35%.

  11. Cosmology from Nx2pt Analyses of SKAO Wide-Area Surveys

    astro-ph.CO 2026-07 conditional novelty 4.0

    SKA-Mid AA4 N×2pt combinations of continuum and HI surveys are forecast to deliver ~1% precision on ΛCDM parameters and useful constraints on w0–wa, Mν and Ωk.

  12. Probing the Baryon Distribution with Fast Radio Bursts

    astro-ph.CO 2026-06 unverdicted novelty 4.0

    Forecasts indicate SKA FRB observations can constrain baryonic feedback models, measure circumgalactic medium properties, and aid reionization studies through DM statistics and scattering timescales.

  13. UNIONS-3500 Weak Lensing: IV. 2D cosmological constraints in harmonic space

    astro-ph.CO 2026-05 conditional novelty 4.0

    UNIONS weak lensing data constrains S8 to 0.891^{+0.057}_{-0.084} in non-tomographic harmonic space, consistent with Planck at 0.79 sigma under LambdaCDM.

  14. UNIONS-3500 Weak Lensing: IV. 2D cosmological constraints in harmonic space

    astro-ph.CO 2026-05 unverdicted novelty 4.0

    UNIONS r-band data constrains S8 to 0.891^{+0.057}_{-0.084} via 2D harmonic-space cosmic shear, consistent with Planck at 0.79 sigma after modeling baryonic feedback and intrinsic alignments.

  15. Cosmology from Clustering of Continuum Galaxies

    astro-ph.CO 2026-06 unverdicted novelty 3.0

    Forecasts angular clustering for a 20,000 sq deg SKAO radio continuum survey reaching O(300-400 million) sources and discusses needed corrections for telescope systematics and population modeling.

  16. Cosmology with Intensity Mapping via Statistics Beyond the Power Spectrum in the SKAO Era

    astro-ph.CO 2026-06 unverdicted novelty 2.0

    Reviews multiple higher-order statistics for 21-cm intensity mapping and forecasts their detectability with SKAO, incorporating noise and foreground effects.

  17. HI Simulations for Cosmology with the SKA Observatory

    astro-ph.CO 2026-06 unverdicted novelty 2.0

    Overview of HI modeling methods finds consistency in cosmic HI density but systematic differences in HI-halo mass relation shape and redshift evolution.

  18. Machine-learning applications for weak-lensing cosmology

    astro-ph.CO 2026-05 unverdicted novelty 2.0

    Machine learning techniques can mitigate limitations in traditional weak-lensing analyses and enhance extraction of cosmological information from galaxy imaging surveys.