Pith. sign in

REVIEW 2 cited by

FoodSky: A Food-oriented Large Language Model that Passes the Chef and Dietetic Examination

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2406.10261 v1 pith:KEXIAZV4 submitted 2024-06-11 cs.CL cs.AI

classification cs.CLcs.AI
keywords foodfoodskychefchinesedieteticllmsvariouscomplexity
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Food is foundational to human life, serving not only as a source of nourishment but also as a cornerstone of cultural identity and social interaction. As the complexity of global dietary needs and preferences grows, food intelligence is needed to enable food perception and reasoning for various tasks, ranging from recipe generation and dietary recommendation to diet-disease correlation discovery and understanding. Towards this goal, for powerful capabilities across various domains and tasks in Large Language Models (LLMs), we introduce Food-oriented LLM FoodSky to comprehend food data through perception and reasoning. Considering the complexity and typicality of Chinese cuisine, we first construct one comprehensive Chinese food corpus FoodEarth from various authoritative sources, which can be leveraged by FoodSky to achieve deep understanding of food-related data. We then propose Topic-based Selective State Space Model (TS3M) and the Hierarchical Topic Retrieval Augmented Generation (HTRAG) mechanism to enhance FoodSky in capturing fine-grained food semantics and generating context-aware food-relevant text, respectively. Our extensive evaluations demonstrate that FoodSky significantly outperforms general-purpose LLMs in both chef and dietetic examinations, with an accuracy of 67.2% and 66.4% on the Chinese National Chef Exam and the National Dietetic Exam, respectively. FoodSky not only promises to enhance culinary creativity and promote healthier eating patterns, but also sets a new standard for domain-specific LLMs that address complex real-world issues in the food domain. An online demonstration of FoodSky is available at http://222.92.101.211:8200.

Discussion (0). Sign in to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. SFOOD: A Multimodal Benchmark for Comprehensive Food Attribute Analysis Beyond RGB with Spectral Insights

    cs.CV 2025-07 conditional novelty 6.0 of 10

    SFOOD combines existing food datasets with self-collected hyperspectral images to create a six-task benchmark, and its evaluations suggest spectral bands improve sweetness and herbal classification while current model...

  2. RecipeGen: A Step-Aligned Multimodal Benchmark for Real-World Recipe Generation

    cs.CV 2025-06 conditional novelty 6.0 of 10

    RecipeGen is a new benchmark with 26,453 recipes, 196,724 step-aligned images, and 4,491 cooking videos, plus three domain-specific evaluation metrics for recipe generation.

Pith tools