Pith. sign in

REVIEW 10 cited by

High-fidelity heralded quantum state preparation and measurement

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2409.05805 v1 pith:KYJZS5CY submitted 2024-09-09 quant-ph physics.atom-ph

classification quant-phphysics.atom-ph
keywords qubitprotocolspamtimesdetecthigh-fidelitylevelmeasurement
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
abstract

We present a novel protocol for high-fidelity qubit state preparation and measurement (SPAM) that combines standard SPAM methods with a series of in-sequence measurements to detect and remove errors. The protocol can be applied in any quantum system with a long-lived (metastable) level and a means to detect population outside of this level without coupling to it. We demonstrate the use of the protocol for three different qubit encodings in a single trapped $^{137}\mathrm{Ba}^+$ ion. For all three, we achieve the lowest reported SPAM infidelities of $7(4) \times 10^{-6}$ (optical qubit), $5(4) \times 10^{-6}$ (metastable-level qubit), and $8(4) \times 10^{-6}$ (ground-level qubit).

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 10 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Microwave-driven same-species sympathetic cooling for trapped ions

    quant-ph 2026-07 accept novelty 8.0 of 10

    Microwave-driven sympathetic cooling with same-isotope 43Ca+ ions cools a shared motional mode to n̄≈0.16 with 1.7(4)×10^-4 data-qubit error per cycle.

  2. Quantum logic operations and algorithms in a single 25-level atomic qudit

    quant-ph 2025-07 conditional novelty 7.0 of 10

    A single 137Ba+ ion acts as a 25-level qudit with 99.51% heralded SPAM fidelity, and runs Bernstein-Vazirani and Toffoli circuits on up to four virtual qubits.

  3. Mid-circuit ground-state cooling and ancilla readout in the $\textit{omg}$ architecture

    quant-ph 2026-08 conditional novelty 6.0 of 10

    Two calcium ions in different electronic manifolds can sympathetically cool their shared motion to near the ground state and perform non-destructive readout of a metastable data qubit via a ground-state ancilla.

  4. AutoQuREO: A Framework for Automated Quantum Resource Estimation and Optimization

    quant-ph 2026-08 conditional novelty 6.0 of 10

    AutoQuREO automates full-stack quantum resource estimation by learning surrogate models from small compilations and using them for scalable multi-objective co-design, demonstrated on Trotter simulation, iQPE with erro...

  5. Qubit Loss Inference with Stabilizer Codes without Leakage Detection Units

    quant-ph 2026-07 conditional novelty 6.0 of 10

    Loss locations can be inferred from repeated stabilizer syndrome data alone when punctured stabilizer checks anticommute, matching or beating noisy LDU-based correction at low loss rates.

  6. Efficient Implementation of a Quantum Algorithm with a Trapped Ion Qudit

    quant-ph 2025-06 conditional novelty 6.0 of 10

    First implementation of Grover's search on trapped-ion qudits of dimension 5 and 8, with measured success probabilities of 96.8% and 69%.

  7. Spontaneous Raman scattering from metastable states of Ba$^+$

    quant-ph 2025-05 conditional novelty 6.0 of 10

    Measurements of spontaneous Raman scattering from metastable 137Ba+ states agree with the Moore et al. model, supporting predictions of low gate errors at large detunings.

  8. Photonic Networking of Quantum Memories in High-Dimensions

    quant-ph 2025-05 conditional novelty 6.0 of 10

    Remote high-dimensional entanglement between two single trapped-ion qudit memories is demonstrated with time-bin photons, with fidelities up to 0.987(13) and a heralding success fraction that grows as 1 - 1/d.

  9. Spontaneous Raman scattering out of a metastable atomic qubit

    quant-ph 2025-05 conditional novelty 6.0 of 10

    Measured spontaneous Raman scattering rates out of the metastable D5/2 qubit manifold of a single 40Ca+ ion under 976 nm light, confirming the large-detuning scattering model and supporting sub-1e-4 gate error estimates.

  10. Single-qubit gates with errors at the $10^{-7}$ level

    quant-ph 2024-12 accept novelty 6.0 of 10

    Microwave-driven single-qubit gates on a trapped-ion clock qubit achieve a randomized-benchmarking error of 1.5(4)x10^-7 per Clifford gate.

Pith tools