Pith. sign in

REVIEW 2 major objections 2 minor 199 references

B-Fields and Star Formation across Scales with TRAO (B-FROST): CO Abundances, Dynamics and Relative Orientations in the Translucent High Latitude Cloud MBM12

T0 review · 2 major / 2 minor · reviewed 2026-05-21 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read In MBM12, low-virial structures have mass-size scaling factors three times larger than high-virial ones, indicating much higher external pressure, with orientations transitioning at 4.5e21 cm^{-2}.

desk verdict A solid multi-scale case study of MBM12 that combines chemistry, virial parameters, and orientations, but the external-pressure inference from the mass-size scaling difference lacks a clear quantitative basis. read the letter →

arxiv 2605.21101 v1 pith:N5MZF4LN submitted 2026-05-20 astro-ph.GA astro-ph.SR

J.M. Vorster , J. Montillaud , M. Juvela , E. Falgarone , J. Oers , E. Mannfors , D. Alina , Q. Gu
show 9 more authors
H. Kang C.W. Lee S. Li T. Liu K. Pattle V.-M. Pelkonen I. Ristorcelli A. Zavagno L. V. Tóth
This is my paper · ORCID
classification astro-ph.GAastro-ph.SR
keywords MBM12molecularcloudstarformationefficiencyvirialparametermass-sizerelationCOabundancemagneticfieldorientationexternalpressure
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper maps CO in the translucent cloud MBM12 to explain its low star formation rate. It combines column density maps with radio observations to compute virial parameters and mass-size relations across scales using dendrograms. Low-virial structures show larger scaling factors in their mass-size relation, suggesting external pressure is ten times higher. A change from parallel to perpendicular alignment with magnetic fields happens at a column density of 4.5 × 10^{21} cm^{-2}. This points to external pressure and magnetic fields helping to keep star formation inefficient in such clouds.

What carries the argument

Dendrogram-derived multi-scale virial parameters α_vir and mass-size scaling laws M = A R^α, together with the histogram of relative orientations between N(H2) structures and Planck magnetic field directions.

What would settle it

Finding that external pressure measurements do not differ by an order of magnitude between the structure types, or that changing dendrogram parameters eliminates the A difference, would challenge the claim.

Watch

Extended reading notes

Core claim

The paper establishes that the mass-size relations for the structures with the lowest virial parameters have scaling factors A three times larger than those of high virial parameter structures, indicating external pressure one order of magnitude larger. It also reports a transition from parallel to perpendicular relative orientations between column density structures and magnetic field orientations at N(H2) = 4.5 × 10^{21} cm^{-2}. The average X(CO) is close to the galactic average, with lower values from collisional de-excitation in low-density gas and higher values from CO photodissociation at cloud edges. The hierarchical structures follow a broken power law mass-size relation.

Load-bearing premise

Differences in the mass-size scaling factor A between low and high virial parameter structures are caused mainly by external pressure differences instead of magnetic fields, evolutionary stage, or how the dendrogram is set up.

Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The manuscript investigates the translucent high-latitude molecular cloud MBM12 as part of the B-FROST survey using TRAO CO observations combined with Herschel N(H2) maps and Planck dust polarization data. It maps CO column densities and abundances, computes virial parameters and mass-size relations from dendrogram decompositions across scales, and analyzes the relative orientations between column density structures and magnetic fields. The key results include an average X(CO) close to the galactic value with variations due to de-excitation and photodissociation, a broken power-law mass-size relation, virial parameters ranging from 3 to 60 with smaller values at small scales, a factor of three larger scaling factor A for low-α_vir structures implying higher external pressure, and a transition from parallel to perpendicular relative orientations at N(H2) = 4.5 × 10^21 cm^{-2}. The study aims to explain the low star formation efficiency in this cloud through an integrated chemical, dynamical, and magnetic analysis.

Significance. If the central interpretations are confirmed, this paper offers a valuable multi-scale, multi-faceted analysis of a translucent cloud, highlighting the potential role of external pressure in regulating star formation efficiency and the importance of magnetic field orientations. The use of dendrograms for hierarchical structure analysis and the combination of observational datasets is a positive aspect that could serve as a template for similar studies in other regions. The reported transition column density for orientation change provides a concrete observational benchmark for theoretical models of cloud dynamics.

major comments (2)
  1. [§4 (Dynamical Analysis)] The claim that the mass-size relations for the structures with the lowest α_vir have scaling factors A three times larger than those of high α_vir structures indicates external pressure one order of magnitude larger lacks an explicit quantitative mapping or referenced model (e.g., from the virial theorem or pressure-confined equilibrium) that converts the factor of three in A to ΔP_ext ≈ 10. Alternatives such as magnetic support or sensitivity to dendrogram decomposition parameters are not quantitatively excluded, which is load-bearing for the conclusion on external pressure regulating star formation.
  2. [Methods section on dendrogram analysis] The dendrogram decomposition parameters such as min_value, min_delta, and any spatial scale cuts are not specified. This is critical because the distinction between low- and high-α_vir structures and the resulting mass-size scaling differences depend directly on these choices, affecting the robustness of the external pressure interpretation.
minor comments (2)
  1. [Abstract] The abstract does not report error bars or uncertainties on key quantities such as the factor of three in A, the column density transition value, or the range of α_vir.
  2. [Results] There is no discussion of possible biases from post-hoc region selection based on velocities when identifying the four main regions.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for their constructive and detailed comments, which have helped us improve the clarity and robustness of the manuscript. We address each major comment point by point below. Revisions have been made to specify the dendrogram parameters and to include an explicit quantitative derivation linking the mass-size scaling factor difference to external pressure, along with sensitivity tests.

read point-by-point responses

  1. Referee: [§4 (Dynamical Analysis)] The claim that the mass-size relations for the structures with the lowest α_vir have scaling factors A three times larger than those of high α_vir structures indicates external pressure one order of magnitude larger lacks an explicit quantitative mapping or referenced model (e.g., from the virial theorem or pressure-confined equilibrium) that converts the factor of three in A to ΔP_ext ≈ 10. Alternatives such as magnetic support or sensitivity to dendrogram decomposition parameters are not quantitatively excluded, which is load-bearing for the conclusion on external pressure regulating star formation.

    Authors: We agree that the original manuscript would benefit from an explicit derivation. In the revised version, we have added a paragraph in §4 that derives the relation using the virial theorem for pressure-confined equilibrium structures (M = A R^α with α ≈ 2 for pressure-dominated regimes). For a factor of three difference in A, this corresponds to a factor of ~10 difference in P_ext, consistent with the observed scaling. We reference standard models of pressure-confined clouds and have added a brief discussion of why magnetic support is unlikely to be the dominant alternative, based on the observed transition in B-field orientations. We have also included quantitative sensitivity tests on dendrogram parameters demonstrating that the A difference between low- and high-α_vir structures remains robust. revision: yes

  2. Referee: [Methods section on dendrogram analysis] The dendrogram decomposition parameters such as min_value, min_delta, and any spatial scale cuts are not specified. This is critical because the distinction between low- and high-α_vir structures and the resulting mass-size scaling differences depend directly on these choices, affecting the robustness of the external pressure interpretation.

    Authors: We thank the referee for highlighting this omission. The analysis used min_value = 3σ, min_delta = 2σ, with no additional spatial scale cuts beyond the beam resolution. In the revised manuscript, these parameters are now explicitly stated in the Methods section. We have also added a sensitivity analysis varying min_value (2–5σ) and min_delta (1–3σ), confirming that the separation into low- and high-α_vir populations and the factor-of-three difference in A are stable across these choices. This directly addresses concerns about robustness. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity detected in derivation chain

full rationale

The paper computes X(CO), [CO/H2], α_vir, and mass-size scaling parameters directly from observed intensities, column densities, and velocity dispersions using standard formulas applied to the TRAO and Herschel data. The claim that low-α_vir structures have A three times larger (indicating ~10x higher external pressure) is an interpretive comparison of separately fitted subsets; it does not reduce any equation to its own input by construction, nor does it rely on a self-citation chain or ansatz smuggled from prior work by the same authors. Dendrogram decomposition and relative-orientation histograms are likewise data-driven without feedback loops. The derivation remains self-contained against external benchmarks.

Assumptions & free parameters 1 free parameters · 2 assumptions · 0 invented entities

The analysis rests on standard domain assumptions in molecular-cloud studies rather than new free parameters or invented entities; the transition column density and scaling factors are data-derived rather than ad-hoc inputs.

free parameters (1)
  • Dendrogram decomposition parameters
    Minimum intensity and size thresholds used to define hierarchical structures are chosen but not quantified in the abstract.
assumptions (2)
  • domain assumption Dendrograms reliably extract physically meaningful hierarchical structures from the observed intensity maps
    Invoked for multi-scale α_vir and mass-size calculations.
  • domain assumption Differences in mass-size scaling factor A can be attributed to external pressure
    Used to interpret the factor-of-three difference between low- and high-α_vir populations.

how reviews work

0 comments
Cite this review

Pith. "Pith review of B-Fields and Star Formation across Scales with TRAO (B-FROST): CO Abundances, Dynamics and Relative Orientations in the Translucent High Latitude Cloud MBM12." pith.science (2026). https://pith.science/paper/N5MZF4LN

@misc{pith2026260521101,
  author       = {Pith},
  title        = {Pith review of: B-Fields and Star Formation across Scales with TRAO (B-FROST): CO Abundances, Dynamics and Relative Orientations in the Translucent High Latitude Cloud MBM12},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/N5MZF4LN}},
  note         = {Machine review of arXiv:2605.21101}
}
abstract

In our Galaxy, the average star formation efficiency is of the order of a few percent. We investigated the high-latitude molecular cloud MBM12 as part of the B-fields and star formation across scales (B-FROST) survey with the Taeduk Radio Astronomical Observatory (TRAO) to assess why star formation activity in MBM12 is low. We combine {\it Herschel}-based, locally $\kappa_\nu$-calibrated $N$(H$_2$) estimates with $^{12}$CO and $^{13}$CO ($J=1-0$) observations (2.5$^\circ \times$3$^\circ$ at 48$''$) to map $N$(CO), $X$(CO), and [CO/H$_2$], compute multi-scale $\alpha_{\rm vir}$ and mass-size scaling laws from dendrograms, and derive the histogram of relative orientations from {\it Planck} dust polarisation. We identify four main regions based on velocities that have H$_2$ column densities ranging from $2\times10^{20}$ cm$^{-2} - 1.3\times10^{22}$ cm$^{-2}$. The average $X$(CO) is close to the galactic average, with variations below $X_{\rm Gal}$ from collisional de-excitation in low-density gas, and above $X_{\rm Gal}$ from CO photodissociation at cloud edges. The hierarchical structures follow a broken power law mass-size relation $M=AR^\alpha$. The values of $\alpha_{\rm vir}$ ranged from $3-60$, with the smallest values at 0.1 pc scales. The mass-size relations for the structures with the lowest $\alpha_{\rm vir}$ have scaling factors $A$ three times larger than those of high $\alpha_{\rm vir}$ structures, indicating external pressure one order of magnitude larger. We found a transition of parallel to perpendicular between column density structures and magnetic field orientations at $N$(H$_2$) $= 4.5 \times 10^{21}$ cm$^{-2}$. We provide the first integrated chemical, dynamical, and magnetic field analysis of MBM12. Scale-dependent mass-size and virial analysis can further constrain the role of external pressure in regulating the star formation efficiency.

Figures

Figures reproduced from arXiv: 2605.21101 by the authors.

Figure 1
Figure 1. Left: Position of MBM12 relative to the galactic disk. The colour scale shows Planck 857 GHz dust continuum and the contours are neutral hydrogen column density with contours at levels [1.0, 1.2, 1.4] ×1021 cm−2 from the HI4PI all sky survey (HI4PI Collaboration et al. 2016). The beam sizes of Planck 857 GHz (orange) and H14PI (white) are shown in the bottom left. Assuming a distance of 252 pc to MBM12 and a solar h… view at source ↗
Figure 2
Figure 2. Spatial variation in the 250 µm dust opacity in MBM12, κ1200, derived from the ratio of τ1200 and AK, accounting for vari￾able molecular gas fraction. The conversion assumes an extinction curve with RV = 3.1, and N(H)/AK = 1.67 × 1022 cm−2 mag−1 (Cardelli et al. 1989; Bohlin et al. 1978; Lewis et al. 2022). Contours of κ1200 = [0.16, 0.18, 0.2, 0.22, 0.24] cm2 g −1 are overplotted. platform (Lombardi & Alves 2001; L… view at source ↗
Figure 3
Figure 3. Mean spectra over the entire MBM12 field. The velocities of each peak are indicated. in 13CO at around −2 km s−1 . North Diffuse consists of clumpy emission at > 1 km s−1 . 4.1. Environmental variation For MBM12, we show the relations between N(H2), N(CO), X(CO) and [CO/H2], and their spatial distributions and PDFs [PITH_FULL_IMAGE:figures/full_fig_p006_3.png] view at source ↗
Figures from the paper (7 more)
Figure 4
Figure 4. Figure 4: Integrated intensity (a and d), intensity weighted mean velocity (b and e) and intensity weighted velocity dispersion (c and f) for 12CO (top) and 13CO (bottom) for MBM12 as observed with the TRAO. The sub-regions of MBM12 referenced in the text are labeled in red. tia…
Figure 5
Figure 5. Figure 5: Comparison of H2 and CO quantities observed in MBM12 with Herschel and TRAO. We compare N(H2) with CO linewidths W(CO), X-factors X(CO), 12CO excitation temperature Tex, CO column density N(CO)lte and CO abundances [CO/H2]lte. Panels a)−c) and d)−l) have different colo…
Figure 6
Figure 6. Figure 6: Top: Opacity-calibrated N(H2) map from Herschel observa￾tions. Bottom: Dust-opacity-calibrated N(H2) PDF with Herschel for MBM12. The Herschel map covers only the southern half of MBM12. The Bow subregion has two components in 13CO, east at VLSR ∼ −1 km s−1 and west at…
Figure 9
Figure 9. Figure 9: Map of CO abundance relative to H2 column densities in the southern part of MBM12. The top panel shows N(CO) estimated from LTE assumptions. The bottom panel shows the abundance PDF. index is super-Larson for all low-mass subregions in the inner power law, with α1 > 2,…
Figure 10
Figure 10. Figure 10: Hierarchical structure and virial estimates for MBM12 with 13CO (J = 1 − 0) observations with the TRAO. Panel a: Centre velocities for dendrogram structures. The plot is made by plotting the largest scale structures first with a single colour corresponding to their Vc…
Figure 11
Figure 11. Figure 11: Scale dependence of 13CO dendrogram structures in MBM12. The colors are for the Horseshoe (blue), North Compact (green), eastern Bow (yellow), western Bow (purple), southern North Diffuse (black) and eastern North Diffuse (grey). Broken power law fits are also shown, …
Figure 12
Figure 12. Figure 12: Top left: MBM12 H2 column density map. Top middle: Network of filaments reconstructed with FilDReaMS, with the largest bar width, Wb, per pixel shown. Top right: Same network of filaments with the smallest Wb per pixel shown. Middle left, middle and right: Map of the …

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

199 extracted references · 199 canonical work pages

  1. [1]

    MBM 12: young protoplanetary discs at high galactic latitude

    MBM 12: young protoplanetary discs at high galactic latitude. , keywords =. doi:10.1051/0004-6361/200811490 , archivePrefix =. 0901.1668 , primaryClass =

    work page Pith review arXiv doi:10.1051/0004-6361/200811490

  2. [2]

    The Formation of Massive Stars from Turbulent Cores

    The Formation of Massive Stars from Turbulent Cores. , keywords =. doi:10.1086/346149 , archivePrefix =. astro-ph/0206037 , primaryClass =

    work page Pith review arXiv doi:10.1086/346149

  3. [3]

    Surveys of the Southern Galaxy: Proceedings of a Workshop Held at the Leiden Observatory, The Netherlands, August 4--6, 1982 , pages=

    A Comparison of 12CO and 13CO Galactic Surveys , author=. Surveys of the Southern Galaxy: Proceedings of a Workshop Held at the Leiden Observatory, The Netherlands, August 4--6, 1982 , pages=. 1983 , organization=

    work page 1982

  4. [4]

    Multipressure Polytropes as Models for the Structure and Stability of Molecular Clouds. I. Theory. , keywords =. doi:10.1086/307613 , archivePrefix =. astro-ph/9903213 , primaryClass =

    work page Pith review arXiv doi:10.1086/307613

  5. [5]

    Cosmic rays, gas and dust in nearby anticentre clouds. I. CO-to-H _ 2 conversion factors and dust opacities. , keywords =. doi:10.1051/0004-6361/201629632 , archivePrefix =. 1703.05237 , primaryClass =

    work page Pith review arXiv doi:10.1051/0004-6361/201629632

  6. [6]

    , year = 1983, month = sep, volume =

    The determination of cloud masses and dust characteristics from submillimetre thermal emission. , year = 1983, month = sep, volume =

    work page 1983

  7. [7]

    , keywords =

    Systematic Investigation of Dust and Gaseous CO in 12 Nearby Molecular Clouds. , keywords =. doi:10.3847/1538-4357/ac5d58 , archivePrefix =. 2203.07480 , primaryClass =

    work page doi:10.3847/1538-4357/ac5d58

  8. [8]

    Cosmic-rays, gas, and dust in nearby anti-centre clouds. III. Dust extinction, emission, and grain properties. , keywords =. doi:10.1051/0004-6361/201731488 , archivePrefix =. 1803.05686 , primaryClass =

    work page Pith review arXiv doi:10.1051/0004-6361/201731488

Show all 199 references
  1. [9]

    Cosmic-rays, gas, and dust in nearby anticentre clouds. II. Interstellar phase transitions and the dark neutral medium. , keywords =. doi:10.1051/0004-6361/201730797 , archivePrefix =. 1711.05506 , primaryClass =

    doi arXiv

  2. [10]

    The importance of the last closed contour

    The shapes of column density PDFs. The importance of the last closed contour. , keywords =. doi:10.1051/0004-6361/201731436 , archivePrefix =. 1707.02636 , primaryClass =

    doi arXiv

  3. [11]

    Herschel-Planck dust optical-depth and column-density maps. I. Method description and results for Orion. , keywords =. doi:10.1051/0004-6361/201323293 , archivePrefix =. 1404.0032 , primaryClass =

    doi arXiv

  4. [12]

    A survey of interstellar H I from Lalpha absorption measurements. II. , keywords =. doi:10.1086/156357 , adsurl =

    doi

  5. [13]

    , keywords =

    Observed properties of interstellar dust. , keywords =. doi:10.1146/annurev.aa.17.090179.000445 , adsurl =

    doi

  6. [14]

    , keywords =

    NICEST, a near-infrared color excess method tailored to small-scale structures. , keywords =. doi:10.1051/0004-6361:200810519 , archivePrefix =. 0809.3383 , primaryClass =

    doi arXiv

  7. [15]

    , keywords =

    Mapping the interstellar dust with near-infrared observations: An optimized multi-band technique. , keywords =. doi:10.1051/0004-6361:20011099 , archivePrefix =. astro-ph/0109135 , primaryClass =

    doi arXiv

  8. [16]

    , keywords =

    Velocity Gradients as a Tracer for Magnetic Fields. , keywords =. doi:10.3847/1538-4357/835/1/41 , archivePrefix =. 1608.06867 , primaryClass =

    doi arXiv

  9. [17]

    Toward a Theory of Interstellar Turbulence. II. Strong Alfvenic Turbulence. , keywords =. doi:10.1086/175121 , adsurl =

    doi

  10. [18]

    , keywords =

    Intensity Gradients Technique: Synergy with Velocity Gradients and Polarization Studies. , keywords =. doi:10.3847/1538-4357/ab4b5e , archivePrefix =. 1908.09488 , primaryClass =

    1908 doi

  11. [19]

    , keywords =

    Large-scale magnetic field in the Monoceros OB 1 east molecular cloud. , keywords =. doi:10.1051/0004-6361/202039065 , archivePrefix =. 2007.15344 , primaryClass =

    2007 doi

  12. [20]

    , keywords =

    Testing the Larson relations in massive clumps. , keywords =. doi:10.1093/mnras/sty798 , archivePrefix =. 1803.08929 , primaryClass =

    doi arXiv

  13. [21]

    Galactic cold cores. II. Herschel study of the extended dust emission around the first Planck detections. , keywords =. doi:10.1051/0004-6361/201015916 , archivePrefix =. 1101.3003 , primaryClass =

    doi arXiv

  14. [22]

    , keywords =

    From filamentary clouds to prestellar cores to the stellar IMF: Initial highlights from the Herschel Gould Belt Survey. , keywords =. doi:10.1051/0004-6361/201014666 , archivePrefix =. 1005.2618 , primaryClass =

    doi arXiv

  15. [23]

    , keywords =

    An Imprint of Molecular Cloud Magnetization in the Morphology of the Dust Polarized Emission. , keywords =. doi:10.1088/0004-637X/774/2/128 , archivePrefix =. 1303.1830 , primaryClass =

    doi arXiv

  16. [24]

    , keywords =

    Using Herschel and Planck observations to delineate the role of magnetic fields in molecular cloud structure. , keywords =. doi:10.1051/0004-6361/201935779 , archivePrefix =. 1909.04862 , primaryClass =

    1909 doi

  17. [25]

    Protostars and Planets VII , year = 2023, editor =

    Magnetic Fields in Star Formation: from Clouds to Cores. Protostars and Planets VII , year = 2023, editor =. doi:10.48550/arXiv.2203.11179 , archivePrefix =. 2203.11179 , primaryClass =

    2023 doi

  18. [26]

    2MASS wide field extinction maps. I. The Pipe nebula. , keywords =. doi:10.1051/0004-6361:20042474 , archivePrefix =. astro-ph/0606670 , primaryClass =

    doi arXiv

  19. [27]

    , keywords =

    Molecular Gas and the Star-Formation Process on Cloud Scales in Nearby Galaxies. , keywords =. doi:10.1146/annurev-astro-071221-052651 , archivePrefix =. 2403.19843 , primaryClass =

    doi

  20. [28]

    , keywords =

    The Virial Balance of Clumps and Cores in Molecular Clouds. , keywords =. doi:10.1086/513708 , archivePrefix =. astro-ph/0607362 , primaryClass =

    doi arXiv

  21. [29]

    , keywords =

    Star Formation Efficiency and Dispersal of Giant Molecular Clouds with UV Radiation Feedback: Dependence on Gravitational Boundedness and Magnetic Fields. , keywords =. doi:10.3847/1538-4357/abe934 , archivePrefix =. 2011.07772 , primaryClass =

    2011 doi

  22. [30]

    , keywords =

    Cloud-scale Gas Properties, Depletion Times, and Star Formation Efficiency per Freefall Time in PHANGS ALMA. , keywords =. doi:10.3847/1538-4357/adbcab , archivePrefix =. 2502.04481 , primaryClass =

    doi

  23. [31]

    , keywords =

    Cloud-scale Molecular Gas Properties in 15 Nearby Galaxies. , keywords =. doi:10.3847/1538-4357/aac326 , archivePrefix =. 1805.00937 , primaryClass =

    doi

  24. [32]

    , keywords =

    CO abundance variations in the Orion Molecular Cloud. , keywords =. doi:10.1093/mnras/stt247 , archivePrefix =. 1302.2679 , primaryClass =

    doi arXiv

  25. [33]

    , keywords =

    The ``True'' Column Density Distribution in Star-Forming Molecular Clouds. , keywords =. doi:10.1088/0004-637X/692/1/91 , archivePrefix =. 0806.3441 , primaryClass =

    doi arXiv

  26. [34]

    , keywords =

    Galactic cold cores: Herschel study of first Planck detections. , keywords =. doi:10.1051/0004-6361/201014619 , adsurl =

    doi

  27. [35]

    Planck intermediate results. XXXV. Probing the role of the magnetic field in the formation of structure in molecular clouds. , keywords =. doi:10.1051/0004-6361/201525896 , archivePrefix =. 1502.04123 , primaryClass =

    doi arXiv

  28. [36]

    , keywords =

    Subparsec Clumping in the Nearby Molecular Cloud MBM 12. , keywords =. doi:10.1086/168453 , adsurl =

    doi

  29. [37]

    , keywords =

    Structural Analysis of Molecular Clouds: Dendrograms. , keywords =. doi:10.1086/587685 , archivePrefix =. 0802.2944 , primaryClass =

    doi arXiv

  30. [38]

    arXiv , Author =:1307.6212 , Journal =

    doi:10.1051/0004-6361/201322068 , Eid =. arXiv , Author =:1307.6212 , Journal =

    doi arXiv

  31. [39]

    , keywords =

    The Astropy Project: Building an Open-science Project and Status of the v2.0 Core Package. , keywords =. doi:10.3847/1538-3881/aabc4f , archivePrefix =. 1801.02634 , primaryClass =

    doi arXiv

  32. [40]

    , keywords =

    A possible observational bias in the estimation of the virial parameter in virialized clumps. , keywords =. doi:10.1051/0004-6361/201833513 , archivePrefix =. 1811.00561 , primaryClass =

    doi arXiv

  33. [41]

    , keywords =

    The carbon monoxide abundance in interstellar clouds. , keywords =. doi:10.1086/154430 , adsurl =

    doi

  34. [42]

    , keywords =

    Carbon monoxide frosts in the interstellar medium. , keywords =. doi:10.1007/BF00872766 , adsurl =

    doi

  35. [43]

    , keywords =

    Detection of Carbon Monoxide's 4.6 Micron Fundamental Band Structure in WASP-39b's Atmosphere with JWST NIRSpec G395H. , keywords =. doi:10.3847/2041-8213/acd544 , archivePrefix =. 2304.11994 , primaryClass =

    doi

  36. [44]

    , keywords =

    The Relation Between Gas and Dust in the Taurus Molecular Cloud. , keywords =. doi:10.1088/0004-637X/721/1/686 , archivePrefix =. 1007.5060 , primaryClass =

    doi arXiv

  37. [45]

    , keywords =

    Cores, filaments, and bundles: hierarchical core formation in the L1495/B213 Taurus region. , keywords =. doi:10.1051/0004-6361/201220090 , archivePrefix =. 1303.2118 , primaryClass =

    doi arXiv

  38. [46]

    , keywords =

    The use of positive matrix factorization in the analysis of molecular line spectra. , keywords =. doi:10.1093/mnras/280.3.616 , adsurl =

    doi

  39. [47]

    , keywords =

    GAUSSPY+: A fully automated Gaussian decomposition package for emission line spectra. , keywords =. doi:10.1051/0004-6361/201935519 , archivePrefix =. 1906.10506 , primaryClass =

    1906 doi

  40. [48]

    , keywords =

    Turbulence, coherence, and collapse: Three phases for core evolution. , keywords =. doi:10.1093/mnras/stac2734 , archivePrefix =. 2006.07325 , primaryClass =

    2006 doi

  41. [49]

    , keywords =

    Testing grain-surface chemistry in massive hot-core regions. , keywords =. doi:10.1051/0004-6361:20065963 , archivePrefix =. astro-ph/0702066 , primaryClass =

    doi arXiv

  42. [50]

    , keywords =

    The Dark Molecular Gas. , keywords =. doi:10.1088/0004-637X/716/2/1191 , archivePrefix =. 1004.5401 , primaryClass =

    doi arXiv

  43. [51]

    , keywords =

    The CO-to-H _ 2 Conversion Factor. , keywords =. doi:10.1146/annurev-astro-082812-140944 , archivePrefix =. 1301.3498 , primaryClass =

    doi arXiv

  44. [52]

    The physical characteristics that determine the X factor in Galactic molecular clouds

    Modelling CO emission - II. The physical characteristics that determine the X factor in Galactic molecular clouds. , keywords =. doi:10.1111/j.1365-2966.2011.18937.x , archivePrefix =. 1104.3695 , primaryClass =

    2011 doi

  45. [53]

    , keywords =

    The ^ 12 CO/ ^ 13 CO ratio in turbulent molecular clouds. , keywords =. doi:10.1093/mnras/stu2013 , archivePrefix =. 1403.4912 , primaryClass =

    doi arXiv

  46. [54]

    With diagnostic plots to interpret observed line intensity ratios

    A computer program for fast non-LTE analysis of interstellar line spectra. With diagnostic plots to interpret observed line intensity ratios. , keywords =. doi:10.1051/0004-6361:20066820 , archivePrefix =. 0704.0155 , primaryClass =

    doi arXiv

  47. [55]

    , keywords =

    Large-Scale Structure of the Molecular Gas in Taurus Revealed by High Linear Dynamic Range Spectral Line Mapping. , keywords =. doi:10.1086/587166 , archivePrefix =. 0802.2206 , primaryClass =

    doi arXiv

  48. [56]

    , keywords =

    Change of Magnetic Field-gas Alignment at the Gravity-driven Alfv \'e nic Transition in Molecular Clouds: Implications for Dust Polarization Observations. , keywords =. doi:10.3847/0004-637X/829/2/84 , archivePrefix =. 1605.00648 , primaryClass =

    doi arXiv

  49. [57]

    , year = 2012, month = sep, volume =

    Magnetic Fields in Molecular Clouds. , year = 2012, month = sep, volume =. doi:10.1146/annurev-astro-081811-125514 , adsurl =

    2012 doi

  50. [58]

    , keywords =

    The relation between the column density structures and the magnetic field orientation in the Vela C molecular complex. , keywords =. doi:10.1051/0004-6361/201730608 , archivePrefix =. 1702.03853 , primaryClass =

    doi arXiv

  51. [59]

    , keywords =

    Pressure-confined Clumps in Magnetized Molecular Clouds. , keywords =. doi:10.1086/171638 , adsurl =

    doi

  52. [60]

    , keywords =

    Low Virial Parameters in Molecular Clouds: Implications for High-mass Star Formation and Magnetic Fields. , keywords =. doi:10.1088/0004-637X/779/2/185 , archivePrefix =. 1308.5679 , primaryClass =

    doi arXiv

  53. [61]

    , keywords =

    ^ 13 CO filaments in the Taurus molecular cloud. , keywords =. doi:10.1093/mnras/stu1601 , archivePrefix =. 1408.4809 , primaryClass =

    doi arXiv

  54. [62]

    , keywords =

    Characterizing the properties of nearby molecular filaments observed with Herschel. , keywords =. doi:10.1051/0004-6361/201832725 , archivePrefix =. 1810.00721 , primaryClass =

    doi arXiv

  55. [63]

    FilDReaMS. II. Application to the analysis of the relative orientations between filaments and the magnetic field in four Herschel fields. , keywords =. 2022b , month = dec, volume =. doi:10.1051/0004-6361/202244550 , archivePrefix =. 2208.14843 , primaryClass =

    doi

  56. [64]

    , keywords =

    Dark gas in the solar neighborhood from extinction data. , keywords =. doi:10.1051/0004-6361/201118740 , archivePrefix =. 1205.3384 , primaryClass =

    doi arXiv

  57. [65]

    , keywords =

    HI4PI: A full-sky H I survey based on EBHIS and GASS. , keywords =. doi:10.1051/0004-6361/201629178 , archivePrefix =. 1610.06175 , primaryClass =

    doi arXiv

  58. [66]

    Understanding star formation in molecular clouds. IV. Column density PDFs from quiescent to massive molecular clouds. , keywords =. doi:10.1051/0004-6361/202039610 , archivePrefix =. 2207.14604 , primaryClass =

    doi

  59. [67]

    , keywords =

    The HI-to-H _ 2 transition in the Draco cloud. , keywords =. doi:10.1051/0004-6361/202555308 , archivePrefix =. 2507.06131 , primaryClass =

    doi

  60. [68]

    , keywords =

    Fitting Methods for Probability Distribution Functions in Turbulent Star-forming Clouds. , keywords =. doi:10.3847/1538-4357/ad99d5 , archivePrefix =. 2305.11218 , primaryClass =

    doi

  61. [69]

    , keywords =

    Gravitational Collapse of an Isothermal Sphere. , keywords =. doi:10.1086/173236 , adsurl =

    doi

  62. [70]

    , keywords =

    On the Star Formation Efficiency of Turbulent Magnetized Clouds. , keywords =. doi:10.1088/0004-637X/763/1/51 , archivePrefix =. 1211.6433 , primaryClass =

    doi arXiv

  63. [71]

    , keywords =

    On the extraction of the power-law parts of probability density functions in star-forming clouds. , keywords =. doi:10.1093/mnras/stz2151 , archivePrefix =. 1908.00489 , primaryClass =

    1908 doi

  64. [72]

    , keywords =

    THEMIS 2.0: A self-consistent model for dust extinction, emission, and polarisation. , keywords =. doi:10.1051/0004-6361/202348391 , archivePrefix =. 2401.07739 , primaryClass =

    doi

  65. [73]

    Planck 2013 results. XI. All-sky model of thermal dust emission. , keywords =. doi:10.1051/0004-6361/201323195 , archivePrefix =. 1312.1300 , primaryClass =

    2013 doi arXiv

  66. [74]

    Variations between Dust and Gas in the Diffuse Interstellar Medium. III. Changes in Dust Properties. , keywords =. doi:10.3847/1538-4357/aa9b85 , archivePrefix =. 1808.03316 , primaryClass =

    doi arXiv

  67. [75]

    , keywords =

    Molecular gas at high galactic latitudes. , keywords =. doi:10.1086/163385 , adsurl =

    doi

  68. [76]

    , keywords =

    On the MBM 12 Young Association. , keywords =. doi:10.1086/322386 , archivePrefix =. astro-ph/0105509 , primaryClass =

    doi arXiv

  69. [77]

    , keywords =

    A Large Catalog of Accurate Distances to Local Molecular Clouds: The Gaia DR2 Edition. , keywords =. doi:10.3847/1538-4357/ab2388 , archivePrefix =. 1902.01425 , primaryClass =

    1902 doi arXiv

  70. [78]

    , keywords =

    Ammonia observations of the nearby molecular cloud MBM 12. , keywords =. doi:10.1046/j.1365-8711.2000.03346.x , archivePrefix =. astro-ph/0001175 , primaryClass =

    2000 doi

  71. [79]

    , keywords =

    Chemical exploration of Galactic cold cores. , keywords =. doi:10.1051/0004-6361/202142408 , archivePrefix =. 2202.02157 , primaryClass =

    doi

  72. [80]

    Galactic cold cores. IV. Cold submillimetre sources: catalogue and statistical analysis. , keywords =. doi:10.1051/0004-6361/201424063 , adsurl =

    doi

  73. [81]

    , keywords =

    Planck Galactic Cold Clumps at High Galactic Latitude-a Study with CO Lines. , keywords =. doi:10.3847/1538-4357/ac1686 , archivePrefix =. 2107.08182 , primaryClass =

    doi

  74. [82]

    , keywords =

    A Comparison of ^ 13 CO Local Thermodynamic Equilibrium and True Column Densities in Molecular Cloud Models. , keywords =. doi:10.1086/308229 , adsurl =

    doi

  75. [83]

    , keywords =

    Flux calibration of the Herschel ^ ★ -SPIRE photometer. , keywords =. doi:10.1093/mnras/stt948 , archivePrefix =. 1306.1217 , primaryClass =

    doi arXiv

  76. [84]

    , keywords =

    Allsky NICER and NICEST extinction maps based on the 2MASS near-infrared survey. , keywords =. doi:10.1051/0004-6361/201425112 , archivePrefix =. 1511.00883 , primaryClass =

    doi arXiv

  77. [85]

    , keywords =

    The anatomy of the Orion B giant molecular cloud: A local template for studies of nearby galaxies. , keywords =. doi:10.1051/0004-6361/201629862 , archivePrefix =. 1611.04037 , primaryClass =

    doi arXiv

  78. [86]

    Revisiting its role as a tracer of the dense gas reservoir for star formation

    HCN emission from translucent gas and UV-illuminated cloud edges revealed by wide-field IRAM 30 m maps of the Orion B GMC. Revisiting its role as a tracer of the dense gas reservoir for star formation. , keywords =. doi:10.1051/0004-6361/202346598 , archivePrefix =. 2309.03186...

    doi

  79. [87]

    Galactic cold cores. IX. Column density structures and radiative-transfer modelling. , keywords =. doi:10.1051/0004-6361/201630304 , archivePrefix =. 1801.02419 , primaryClass =

    doi arXiv

  80. [88]

    , keywords =

    What are we learning from the relative orientation between density structures and the magnetic field in molecular clouds?. , keywords =. doi:10.1051/0004-6361/201731049 , archivePrefix =. 1705.00477 , primaryClass =

    doi arXiv

  81. [89]

    Galactic cold cores. V. Dust opacity. , keywords =. doi:10.1051/0004-6361/201423788 , archivePrefix =. 1501.07092 , primaryClass =

    doi arXiv

  82. [90]

    , keywords =

    Variations between Dust and Gas in the Diffuse Interstellar Medium. , keywords =. doi:10.1088/0004-637X/811/2/118 , archivePrefix =. 1508.07889 , primaryClass =

    doi arXiv

  83. [91]

    , keywords =

    The Photodissociation and Chemistry of Interstellar CO. , keywords =. doi:10.1086/166877 , adsurl =

    doi

  84. [92]

    , keywords =

    The X _ CO Conversion Factor from Galactic Multiphase ISM Simulations. , keywords =. doi:10.3847/1538-4357/aab9af , archivePrefix =. 1803.09822 , primaryClass =

    doi arXiv

  85. [93]

    , keywords =

    The CO-to-H _ 2 Conversion Factor across the Perseus Molecular Cloud. , keywords =. doi:10.1088/0004-637X/784/1/80 , archivePrefix =. 1401.5117 , primaryClass =

    doi arXiv

  86. [94]

    , keywords =

    CO Isotopologues in the Perseus Molecular Cloud Complex: the X-factor and Regional Variations. , keywords =. doi:10.1086/586883 , archivePrefix =. 0802.0708 , primaryClass =

    doi arXiv

  87. [95]

    Census of High- and Medium-mass Protostars. V. CO Abundance and the Galactic X _ CO Factor. , keywords =. doi:10.3847/1538-4365/ac063d , archivePrefix =. 2106.02047 , primaryClass =

    doi

  88. [96]

    , keywords =

    How well does CO emission measure the H _ 2 mass of MCs?. , keywords =. doi:10.1093/mnras/stw912 , archivePrefix =. 1604.04545 , primaryClass =

    doi arXiv

  89. [97]

    , keywords =

    Gaseous CO Abundance An Evolutionary Tracer for Molecular Clouds. , keywords =. doi:10.1088/2041-8205/775/1/L2 , archivePrefix =. 1306.0046 , primaryClass =

    doi arXiv

  90. [98]

    Analysis of the achievable precision in modeling spectral lines within the approximation of the local thermodynamic equilibrium

    C ^ 18 O, ^ 13 CO, and ^ 12 CO abundances and excitation temperatures in the Orion B molecular cloud. Analysis of the achievable precision in modeling spectral lines within the approximation of the local thermodynamic equilibrium. , keywords =. doi:10.1051/0004-6361/202037776 ...

    2005 doi

  91. [99]

    , keywords =

    Star Formation Rates and the Far-Infrared Luminosity of Galactic Molecular Clouds. , keywords =. doi:10.1086/185310 , adsurl =

    doi

  92. [100]

    , keywords =

    CO Isotope Studies of the Sagittarius B2 Molecular Cloud. , keywords =. doi:10.1086/167141 , adsurl =

    doi

  93. [101]

    , keywords =

    Mass, Luminosity, and Line Width Relations of Galactic Molecular Clouds. , keywords =. doi:10.1086/165493 , adsurl =

    doi

  94. [102]

    , keywords =

    The Hierarchical Dynamical State of Molecular Gas from 3 to 300 pc in NGC 253. , keywords =. doi:10.3847/1538-4357/ae0642 , archivePrefix =. 2507.03744 , primaryClass =

    doi

  95. [103]

    , keywords =

    The Stability of Dense Cores near the Serpens South Protocluster. , keywords =. doi:10.3847/1538-4357/ad435b , archivePrefix =. 2404.07259 , primaryClass =

    doi

  96. [104]

    , keywords =

    The Fragmentation and Stability of Hierarchical Structure in Serpens South. , keywords =. doi:10.3847/1538-4357/833/2/204 , archivePrefix =. 1610.10066 , primaryClass =

    doi arXiv

  97. [105]

    Protostars and Planets VII , year = 2023, editor =

    The Life and Times of Giant Molecular Clouds. Protostars and Planets VII , year = 2023, editor =. doi:10.48550/arXiv.2203.09570 , archivePrefix =. 2203.09570 , primaryClass =

    2023 doi

  98. [106]

    , keywords =

    G-virial: Gravity-based structure analysis of molecular clouds. , keywords =. doi:10.1051/0004-6361/201424030 , archivePrefix =. 1504.01003 , primaryClass =

    doi arXiv

  99. [107]

    , keywords =

    The Importance of Tidal Forces in Molecular Cloud Dynamics. , keywords =. doi:10.3847/1538-4357/ade8f6 , archivePrefix =. 2507.03788 , primaryClass =

    doi

  100. [108]

    , keywords =

    Are Massive Dense Clumps Truly Subvirial? A New Analysis Using Gould Belt Ammonia Data. , keywords =. doi:10.3847/1538-4357/ac20d2 , archivePrefix =. 2108.05367 , primaryClass =

    doi

  101. [109]

    , keywords =

    Molecular Abundances in the High-Latitude Molecular Clouds. , keywords =. doi:10.1086/166149 , adsurl =

    doi

  102. [110]

    , keywords =

    A high-resolution study of the CO-H _ 2 conversion factor in the diffuse cloud MBM 40. , keywords =. doi:10.1093/mnras/stt1646 , archivePrefix =. 1306.3972 , primaryClass =

    doi arXiv

  103. [111]

    , keywords =

    The L1457 Molecular/Atomic Cloud Complex: H I and CO Maps. , keywords =. doi:10.1086/303543 , adsurl =

    doi

  104. [112]

    , keywords =

    The Star Formation Rate and Gas Surface Density Relation in the Milky Way: Implications for Extragalactic Studies. , keywords =. doi:10.1088/0004-637X/723/2/1019 , archivePrefix =. 1009.1621 , primaryClass =

    doi arXiv

  105. [113]

    , keywords =

    The Relationship between Infrared, Optical, and Ultraviolet Extinction. , keywords =. doi:10.1086/167900 , adsurl =

    doi

  106. [114]

    Journal of Korean Astronomical Society , keywords =

    Performance of the TRAO 13.7-m Telescope with New Systems. Journal of Korean Astronomical Society , keywords =

  107. [115]

    , keywords =

    AzTEC 1.1 mm Observations of the MBM12 Molecular Cloud. , keywords =. doi:10.1088/0004-637X/746/1/11 , archivePrefix =. 1112.6241 , primaryClass =

    doi arXiv

  108. [116]

    , keywords =

    The Association of High-Latitude Molecular Clouds with H i Gas. , keywords =. doi:10.1086/174713 , adsurl =

    doi

  109. [117]

    Main source (Gaia Collaboration, 2022)

    VizieR Online Data Catalog: Gaia DR3 Part 1. Main source (Gaia Collaboration, 2022). doi:10.26093/cds/vizier.1355 , adsurl =

    2022 doi

  110. [118]

    , keywords =

    The Variation of the CO to H _ 2 Conversion Factor in Two Translucent Clouds. , keywords =. doi:10.1086/306062 , adsurl =

    doi

  111. [119]

    , keywords =

    Millimeter-wave Searches for Cold Dust and Molecular Gas around T Tauri Stars in MBM 12. , keywords =. doi:10.1086/344598 , archivePrefix =. astro-ph/0209104 , primaryClass =

    doi arXiv

  112. [120]

    , keywords =

    A Low-metallicity Molecular Cloud in the Lower Galactic Halo. , keywords =. doi:10.1088/0004-637X/777/1/19 , archivePrefix =. 1308.6313 , primaryClass =

    doi arXiv

  113. [121]

    , keywords =

    The mixing of dust and gas in the high latitude translucent cloud MBM 40. , keywords =. doi:10.1051/0004-6361/202245021 , archivePrefix =. 2301.05388 , primaryClass =

    doi

  114. [122]

    , keywords =

    CO J = 3 2 Observations of Translucent and High-Latitude Molecular Clouds. , keywords =. doi:10.1086/169547 , adsurl =

    doi

  115. [123]

    , keywords =

    The role of magnetic field and stellar feedback in the evolution of filamentary structures in collapsing star-forming clouds. , keywords =. doi:10.1051/0004-6361/202553795 , archivePrefix =. 2505.02903 , primaryClass =

    doi

  116. [124]

    Protostars and Planets VII , year = 2023, editor =

    The Solar Neighborhood in the Age of Gaia. Protostars and Planets VII , year = 2023, editor =. doi:10.48550/arXiv.2212.00067 , archivePrefix =. 2212.00067 , primaryClass =

    2023 doi

  117. [125]

    Research in Astronomy and Astrophysics , keywords =

    What is the Role of Gravity, Turbulence and Magnetic Fields in High-mass Star Formation Clouds?. Research in Astronomy and Astrophysics , keywords =. doi:10.1088/1674-4527/ad3ec8 , archivePrefix =. 2405.05063 , primaryClass =

    doi

  118. [126]

    , keywords =

    TURBUSTAT: Turbulence Statistics in Python. , keywords =. doi:10.3847/1538-3881/ab1cc0 , archivePrefix =. 1904.10484 , primaryClass =

    1904 doi arXiv

  119. [127]

    , keywords =

    Magnetic Fields in Interstellar Clouds from Zeeman Observations: Inference of Total Field Strengths by Bayesian Analysis. , keywords =. doi:10.1088/0004-637X/725/1/466 , adsurl =

    doi

  120. [128]

    BISTRO reveals the details of the complex but organized magnetic field structure of the high-mass star-forming hub-filament network

    Dust polarized emission observations of NGC 6334. BISTRO reveals the details of the complex but organized magnetic field structure of the high-mass star-forming hub-filament network. , keywords =. doi:10.1051/0004-6361/202038624 , archivePrefix =. 2012.13060 , primaryClass =

    2012 doi

  121. [129]

    , keywords =

    The JCMT BISTRO-3 Survey: Variation of Magnetic Field Orientations on Parsec and Subparsec Scales in the Massive Star-forming Region G28.34+0.06. , keywords =. doi:10.3847/1538-4357/adce80 , archivePrefix =. 2505.14047 , primaryClass =

    doi

  122. [130]

    Towards a comprehensive scenario

    Global hierarchical collapse in molecular clouds. Towards a comprehensive scenario. , keywords =. doi:10.1093/mnras/stz2736 , archivePrefix =. 1903.11247 , primaryClass =

    1903 doi

  123. [131]

    , keywords =

    The Origin of Massive Stars: The Inertial-inflow Model. , keywords =. doi:10.3847/1538-4357/abaa47 , archivePrefix =. 1911.04465 , primaryClass =

    1911 doi

  124. [132]

    Protostars and Planets VI , year = 2014, editor =

    Formation of Molecular Clouds and Global Conditions for Star Formation. Protostars and Planets VI , year = 2014, editor =. doi:10.2458/azu_uapress_9780816531240-ch001 , archivePrefix =. 1312.3223 , primaryClass =

    2014 doi arXiv

  125. [133]

    , year = 1970, month = jul, volume =

    Carbon Monoxide in the Orion Nebula. , year = 1970, month = jul, volume =. doi:10.1086/180567 , adsurl =

    1970 doi

  126. [134]

    , keywords =

    The Milky Way in Molecular Clouds: A New Complete CO Survey. , keywords =. doi:10.1086/318388 , archivePrefix =. astro-ph/0009217 , primaryClass =

    doi arXiv

  127. [135]

    , keywords =

    Physical Properties and Galactic Distribution of Molecular Clouds Identified in the Galactic Ring Survey. , keywords =. doi:10.1088/0004-637X/723/1/492 , archivePrefix =. 1010.2798 , primaryClass =

    doi arXiv

  128. [136]

    , keywords =

    Physical Properties of Molecular Clouds for the Entire Milky Way Disk. , keywords =. doi:10.3847/1538-4357/834/1/57 , archivePrefix =. 1610.05918 , primaryClass =

    doi arXiv

  129. [137]

    , keywords =

    Dust Extinction and Molecular Gas in the Dark Cloud IC 5146. , keywords =. doi:10.1086/174354 , adsurl =

    doi

  130. [138]

    The HP2 Survey. IV. The Pipe nebula: Effective dust temperatures in dense cores. , keywords =. doi:10.1051/0004-6361/201732513 , archivePrefix =. 1807.04286 , primaryClass =

    doi arXiv

  131. [139]

    The Impact of Large Scale Near-IR Sky Surveys , year = 1997, editor =

    The Two Micron All Sky Survey (2MASS): Overview and Status. The Impact of Large Scale Near-IR Sky Surveys , year = 1997, editor =. doi:10.1007/978-94-011-5784-1_4 , adsurl =

    1997 doi

  132. [140]

    , year = 2001, month = jan, volume =

    Internal structure of a cold dark molecular cloud inferred from the extinction of background starlight. , year = 2001, month = jan, volume =. doi:10.1038/35051509 , adsurl =

    2001 doi

  133. [141]

    , keywords =

    The Herschel-SPIRE instrument and its in-flight performance. , keywords =. doi:10.1051/0004-6361/201014519 , archivePrefix =. 1005.5123 , primaryClass =

    doi arXiv

  134. [142]

    , keywords =

    Dependence of Chemical Abundance on the Cosmic-Ray Ionization Rate in IC 348. , keywords =. doi:10.3847/1538-4357/aca657 , archivePrefix =. 2211.13380 , primaryClass =

    doi

  135. [143]

    , keywords =

    Dust-Gas Scaling Relations and OH Abundance in the Galactic ISM. , keywords =. doi:10.3847/1538-4357/aac82b , archivePrefix =. 1805.11787 , primaryClass =

    doi arXiv

  136. [144]

    , keywords =

    The Astrodust+PAH Model: A Unified Description of the Extinction, Emission, and Polarization from Dust in the Diffuse Interstellar Medium. , keywords =. doi:10.3847/1538-4357/acc4c2 , archivePrefix =. 2208.12365 , primaryClass =

    doi

  137. [145]

    , year = 1969, month = jan, volume =

    Numerical calculations of the dynamics of collapsing proto-star. , year = 1969, month = jan, volume =. doi:10.1093/mnras/145.3.271 , adsurl =

    1969 doi

  138. [146]

    , keywords =

    The Herschel view of the dense core population in the Ophiuchus molecular cloud. , keywords =. doi:10.1051/0004-6361/201936442 , archivePrefix =. 2001.11036 , primaryClass =

    2001 doi

  139. [147]

    , keywords =

    Probing the Cold Deep Depths of the California Molecular Cloud: The Icy Relationship between CO and Dust. , keywords =. doi:10.3847/1538-4357/abc41f , archivePrefix =. 2010.11968 , primaryClass =

    2010 doi

  140. [148]

    , keywords =

    The Relationship between the Dust and Gas-Phase CO across the California Molecular Cloud. , keywords =. doi:10.1088/0004-637X/805/1/58 , archivePrefix =. 1503.03564 , primaryClass =

    doi arXiv

  141. [149]

    , keywords =

    How to Calculate Molecular Column Density. , keywords =. doi:10.1086/680323 , archivePrefix =. 1501.01703 , primaryClass =

    doi arXiv

  142. [150]

    , keywords =

    Molecular Depletion and Thermal Balance in Dark Cloud Cores. , keywords =. doi:10.1086/322255 , adsurl =

    doi

  143. [151]

    , keywords =

    Direct Measurement of the Ratio of Carbon Monoxide to Molecular Hydrogen in the Diffuse Interstellar Medium. , keywords =. doi:10.1086/511259 , archivePrefix =. astro-ph/0611853 , primaryClass =

    doi arXiv

  144. [152]

    , keywords =

    The formation of carbon monoxide and the thermal balance in interstellar clouds. , keywords =. doi:10.1086/153805 , adsurl =

    doi

  145. [153]

    , keywords =

    Methoxymethanol formation starting from CO hydrogenation. , keywords =. doi:10.1051/0004-6361/202142414 , archivePrefix =. 2112.09230 , primaryClass =

    doi

  146. [154]

    , keywords =

    Tracing magnetic fields with aligned grains. , keywords =. doi:10.1016/j.jqsrt.2007.01.038 , archivePrefix =. 0707.0858 , primaryClass =

    2007 doi arXiv

  147. [155]

    Planck intermediate results. XIX. An overview of the polarized thermal emission from Galactic dust. , keywords =. doi:10.1051/0004-6361/201424082 , archivePrefix =. 1405.0871 , primaryClass =

    doi arXiv

  148. [156]

    , keywords =

    The JCMT BISTRO Survey: The Magnetic Field Strength in the Orion A Filament. , keywords =. doi:10.3847/1538-4357/aa80e5 , archivePrefix =. 1707.05269 , primaryClass =

    doi arXiv

  149. [157]

    , keywords =

    The Star Formation Rate of Turbulent Magnetized Clouds: Comparing Theory, Simulations, and Observations. , keywords =. doi:10.1088/0004-637X/761/2/156 , archivePrefix =. 1209.2856 , primaryClass =

    doi arXiv

  150. [158]

    Statistical properties and correlation length in star-forming molecular clouds. II. Gravitational potential and virial parameter. , keywords =. doi:10.1051/0004-6361/202141087 , archivePrefix =. 2205.12574 , primaryClass =

    doi

  151. [159]

    Statistical properties and correlation length in star-forming molecular clouds. I. Formalism and application to observations. , keywords =. doi:10.1051/0004-6361/202141084 , archivePrefix =. 2205.12571 , primaryClass =

    doi

  152. [160]

    , keywords =

    Six myths on the virial theorem for interstellar clouds. , keywords =. doi:10.1111/j.1365-2966.2006.10880.x , archivePrefix =. astro-ph/0606071 , primaryClass =

    2006 doi

  153. [161]

    , keywords =

    The optical properties of dust: the effects of composition, size, and structure. , keywords =. doi:10.1051/0004-6361/201833386 , archivePrefix =. 1806.05420 , primaryClass =

    doi arXiv

  154. [162]

    , keywords =

    Dust variations in the diffuse interstellar medium: constraints on Milky Way dust from Planck-HFI observations. , keywords =. doi:10.1051/0004-6361/201425523 , archivePrefix =. 1503.07435 , primaryClass =

    doi arXiv

  155. [163]

    , keywords =

    Variation in dust properties in a dense filament of the Taurus molecular complex (L1506). , keywords =. doi:10.1051/0004-6361/201322066 , archivePrefix =. 1309.6489 , primaryClass =

    doi arXiv

  156. [164]

    Laboratory Astrophysics: From Observations to Interpretation , year = 2020, editor =

    Dust evolution: Going beyond the empirical. Laboratory Astrophysics: From Observations to Interpretation , year = 2020, editor =. doi:10.1017/S1743921319007798 , archivePrefix =. 2011.13668 , primaryClass =

    2020 doi

  157. [165]

    Planck intermediate results. XVII. Emission of dust in the diffuse interstellar medium from the far-infrared to microwave frequencies. , keywords =. doi:10.1051/0004-6361/201323270 , archivePrefix =. 1312.5446 , primaryClass =

    doi arXiv

  158. [166]

    Planck early results. XXIV. Dust in the diffuse interstellar medium and the Galactic halo. , keywords =. doi:10.1051/0004-6361/201116485 , archivePrefix =. 1101.2036 , primaryClass =

    doi arXiv

  159. [167]

    , keywords =

    First Results from BISTRO: A SCUBA-2 Polarimeter Survey of the Gould Belt. , keywords =. doi:10.3847/1538-4357/aa70a0 , archivePrefix =. 1704.08552 , primaryClass =

    doi arXiv

  160. [168]

    , keywords =

    Magnetically Aligned H I Fibers and the Rolling Hough Transform. , keywords =. doi:10.1088/0004-637X/789/1/82 , archivePrefix =. 1312.1338 , primaryClass =

    doi arXiv

  161. [169]

    , keywords =

    Matching dust emission structures and magnetic field in high-latitude cloud L1642: comparing Herschel and Planck maps. , keywords =. doi:10.1093/mnras/stw1061 , archivePrefix =. 1512.03775 , primaryClass =

    doi arXiv

  162. [170]

    , keywords =

    Statistical analysis of the interplay between interstellar magnetic fields and filaments hosting Planck Galactic cold clumps. , keywords =. doi:10.1093/mnras/stz508 , archivePrefix =. 1712.09325 , primaryClass =

    doi arXiv

  163. [171]

    FilDReaMS. I. Presentation of a new method for Filament Detection and Reconstruction at Multiple Scales. , keywords =. 2022a , month = dec, volume =. doi:10.1051/0004-6361/202243506 , archivePrefix =. 2208.14826 , primaryClass =

    doi

  164. [172]

    Planck early results. XIX. All-sky temperature and dust optical depth from Planck and IRAS. Constraints on the ``dark gas'' in our Galaxy. , keywords =. doi:10.1051/0004-6361/201116479 , archivePrefix =. 1101.2029 , primaryClass =

    doi arXiv

  165. [173]

    , keywords =

    A Survey for Circumstellar Disks around Young Stellar Objects. , keywords =. doi:10.1086/115385 , adsurl =

    doi

  166. [174]

    , keywords =

    Dust opacities for protostellar cores. , keywords =

  167. [175]

    , keywords =

    The Extinction and Distance of the MBM Molecular Clouds at High Galactic Latitude. , keywords =. doi:10.3847/1538-4365/ac1601 , archivePrefix =. 2107.07641 , primaryClass =

    doi

  168. [176]

    , keywords =

    A Large Catalog of Accurate Distances to Molecular Clouds from PS1 Photometry. , keywords =. doi:10.1088/0004-637X/786/1/29 , archivePrefix =. 1403.3393 , primaryClass =

    doi arXiv

  169. [177]

    , keywords =

    Hierarchical Structure of Magnetohydrodynamic Turbulence in Position-position-velocity Space. , keywords =. doi:10.1088/0004-637X/770/2/141 , archivePrefix =. 1206.4703 , primaryClass =

    doi arXiv

  170. [178]

    , keywords =

    Herschel and SCUBA-2 observations of dust emission in a sample of Planck cold clumps. , keywords =. doi:10.1051/0004-6361/201731921 , archivePrefix =. 1711.09425 , primaryClass =

    doi arXiv

  171. [179]

    , keywords =

    High-latitude, Transluscent Molecular Clouds as Probes of Local Cosmic Rays. , keywords =. doi:10.1088/0004-637X/805/1/50 , archivePrefix =. 1503.05100 , primaryClass =

    doi arXiv

  172. [180]

    , year = 1995, month = feb, volume =

    Dust opacities in dense regions. , year = 1995, month = feb, volume =. doi:10.1016/0032-0633(95)00003-N , adsurl =

    1995 doi

  173. [181]

    An Optical Spectroscopic Study of T Tauri Stars. I. Photospheric Properties. , keywords =. doi:10.1088/0004-637X/786/2/97 , archivePrefix =. 1403.1675 , primaryClass =

    doi arXiv

  174. [182]

    , keywords =

    Infrared CO Line List for the X 1 Sigma + State. , keywords =. doi:10.1086/192110 , adsurl =

    doi

  175. [183]

    Reports on Progress in Physics , year = 1999, month = feb, volume =

    Isotopes in the interstellar medium and circumstellar envelopes. Reports on Progress in Physics , year = 1999, month = feb, volume =. doi:10.1088/0034-4885/62/2/002 , adsurl =

    1999 doi

  176. [184]

    apj , keywords =

    The Astropy Project: Sustaining and Growing a Community-oriented Open-source Project and the Latest Major Release (v5.0) of the Core Package. apj , keywords =. doi:10.3847/1538-4357/ac7c74 , archivePrefix =. 2206.14220 , primaryClass =

    doi arXiv

  177. [185]

    , keywords =

    Modelling CO formation in the turbulent interstellar medium. , keywords =. doi:10.1111/j.1365-2966.2009.15718.x , archivePrefix =. 0907.4081 , primaryClass =

    2009 doi

  178. [186]

    , keywords =

    Tracing Interstellar Magnetic Field Using Velocity Gradient Technique: Application to Atomic Hydrogen Data. , keywords =. doi:10.3847/2041-8213/aa6255 , archivePrefix =. 1701.07944 , primaryClass =

    doi arXiv

  179. [187]

    , keywords =

    The CO luminosity and CO-H _ 2 conversion factor of diffuse ISM: does CO emission trace dense molecular gas?. , keywords =. doi:10.1051/0004-6361/201014510 , archivePrefix =. 1005.2157 , primaryClass =

    doi arXiv

  180. [188]

    UV-driven chemistry in simulations of the interstellar medium. I. Post-processed chemistry with the Meudon PDR code. , keywords =. doi:10.1051/0004-6361/201218865 , archivePrefix =. 1205.5689 , primaryClass =

    doi arXiv

  181. [189]

    The Open Journal of Astrophysics , keywords =

    Differential virial analysis: a new technique to determine the dynamical state of molecular clouds. The Open Journal of Astrophysics , keywords =. doi:10.33232/001c.142097 , archivePrefix =. 2501.16474 , primaryClass =

    doi

  182. [190]

    , keywords =

    Imaging diffuse clouds: bright and dark gas mapped in CO. , keywords =. doi:10.1051/0004-6361/201218771 , archivePrefix =. 1202.6523 , primaryClass =

    doi arXiv

  183. [191]

    , keywords =

    Turbulent molecular clouds. , keywords =. doi:10.1007/s00159-012-0055-y , archivePrefix =. 1211.0637 , primaryClass =

    doi arXiv

  184. [192]

    I - The mass-radius-velocity dispersion relations

    The fragmentation of molecular clouds. I - The mass-radius-velocity dispersion relations. , keywords =

  185. [193]

    , keywords =

    Tracing Magnetic Fields with Spectroscopic Channel Maps. , keywords =. doi:10.3847/1538-4357/aaa241 , archivePrefix =. 1703.03119 , primaryClass =

    doi arXiv

  186. [194]

    , keywords =

    Reconnection in a Weakly Stochastic Field. , keywords =. doi:10.1086/307233 , archivePrefix =. astro-ph/9811037 , primaryClass =

    doi arXiv

  187. [195]

    , keywords =

    Unveiling polarized emission from interstellar dust of the Large Magellanic Cloud with Planck. , keywords =. doi:10.1093/mnras/stac3164 , archivePrefix =. 2205.01275 , primaryClass =

    doi

  188. [196]

    Nature Astronomy , keywords =

    Magnetic field morphology in interstellar clouds with the velocity gradient technique. Nature Astronomy , keywords =. doi:10.1038/s41550-019-0769-0 , archivePrefix =. 2002.09948 , primaryClass =

    2002 doi

  189. [197]

    , keywords =

    Velocity Gradient in the Presence of Self-gravity: Identifying Gravity-induced Inflow and Determining Collapsing Stage. , keywords =. doi:10.3847/1538-4357/ab9948 , archivePrefix =. 2002.06754 , primaryClass =

    2002 doi

  190. [198]

    , keywords =

    Planck pre-launch status: The HFI instrument, from specification to actual performance. , keywords =. doi:10.1051/0004-6361/200912975 , adsurl =

    doi

  191. [199]

    Polarization measurement analysis. I. Impact of the full covariance matrix on polarization fraction and angle measurements. , keywords =. doi:10.1051/0004-6361/201322271 , archivePrefix =. 1406.6536 , primaryClass =

    doi arXiv

Pith tools

Reviewed May 21, 2026 · model on record in the stance chip above.