Pith. sign in

REVIEW 2 major objections 4 minor 32 references

Time-resolved observation of magnon splitting into vortex gyration and Floquet spin waves

T0 review · 2 major / 4 minor · reviewed 2026-08-03 · deepseek-v4-flash

Pith's one-line read The first scattering step when a vortex dot is driven near its m=−1 spin-wave mode is a three-wave splitting into a gyration magnon and a Floquet spin wave, born synchronously.

desk verdict A careful time-resolved study that makes a plausible case for three-wave splitting as the first scattering event, but the transient separation of real Floquet population from gyration-induced mixing is not fully nailed down. read the letter →

arxiv 2511.10450 v2 pith:ON6VTCR3 submitted 2025-11-13 cond-mat.mtrl-sci cond-mat.mes-hall

classification cond-mat.mtrl-scicond-mat.mes-hall
keywords vortexgyrationFloquetspinwavesmagnonsplittingthree-wavescatteringfrequencycombmagnetictunneljunctiontime-resolvedmicrowavemeasurementazimuthalspin-wavemodes
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper claims that the first scattering event when a magnetic vortex dot is excited near its lowest azimuthal spin-wave mode is a three-wave splitting: the driven mode converts into a vortex-core gyration and a Floquet spin wave simultaneously. The evidence is time-resolved electrical detection showing that the gyration and the first lower sideband appear after a common incubation delay that shrinks to 3 ns when the drive hits the spin-wave resonance and diverges at the scattering threshold. If true, this identifies the trigger mechanism for the magnon frequency comb observed in vortex-state magnets, and shows that the gyrating vortex and the Floquet spin waves are generated together rather than one preceding the other.

What carries the argument

The central identity is the three-wave scattering channel |rf⟩_{(m=-1)} → |g⟩_{(m=+1)} + |SB−⟩_{(m=-2)}, required by conservation of energy (f_rf = f_g + f_{rf}-f_g) and azimuthal number (m: -1 → +1 + (-2)). The paper's experimental machinery is time-resolved I/Q demodulation of the junction voltage, which allows separate tracking of the gyration population at f_g and the sideband population at f_rf − f_g with ~3 ns resolution. The key diagnostic is the comparison of incubation delays: a common delay between the two populations identifies simultaneous birth, while the divergence of that delay at threshold and its minimum at resonance identify the scattering channel.

What would settle it

A single-shot event in which the sideband at f_rf − f_g appears only after the gyration amplitude has already grown to a level where its mixing signal alone can explain the sideband; alternatively, a transient measurement where the sideband appears before the gyration at a detuned drive would disprove the synchronous splitting claim.

Watch

Extended reading notes

Core claim

The paper establishes, from single-shot time-resolved microwave measurements on vortex-state magnetic tunnel junctions, that the forced azimuthal mode |rf⟩ (with azimuthal index m=−1) splits into the gyration mode |g⟩ (m=+1) and a lower sideband Floquet state |SB−⟩ (m=−2). The two daughter excitations grow synchronously: their independently extracted incubation delays (time to reach steady-state amplitude) are one-to-one correlated event by event, and both diverge at the scattering threshold while reaching a minimum at the m=−1 resonance frequency. This synchronous birth is interpreted as the signature of a three-wave splitting process, not a sequential cascade in which gyration would first

Load-bearing premise

The central assumption is that the time-resolved amplitude of the lower sideband at f_rf − f_g, after thresholding and leakage subtraction, reflects the birth of a real Floquet spin wave rather than merely the microwave-mixing image of the gyration; if that assumption fails, the observed synchronous delays do not prove a splitting process.

Editorial extensions

If this is right

  • The gyration and the k=-1 Floquet spin wave are born together, so the Floquet context is not an 'egg-and-chicken' problem.
  • The incubation delay, as short as 3 ns, sets the timescale for the onset of the frequency comb in vortex-based devices.
  • The scattering threshold and delay are controlled by the detuning from the m=-1 eigenmode, implying that resonant pumping is the most efficient route to comb generation.
  • The subsequent population of higher-order Floquet sidebands likely proceeds through a cascade of further scattering events, a process left open by the paper.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Because the sideband signal includes a microwave-mixing contribution proportional to the gyration amplitude, the synchronous-delay evidence would be even stronger if the transient of SB- were compared with the gyration transient after explicitly subtracting that mixing component.
  • The same splitting mechanism may govern the frequency combs seen in other confined magnetic textures, and the 3 ns minimum delay could serve as a benchmark for material and geometry optimization.
  • The divergence of the incubation delay at threshold resembles critical slowing down, suggesting the scattering onset could be modeled as a bifurcation; a test would be whether the delay follows a power law near threshold.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 4 minor

Summary. The manuscript reports time-resolved microwave electrical measurements of a vortex-state magnetic tunnel junction driven by an rf field near the frequency of the m = −1 azimuthal spin-wave mode. The authors observe that the gyration-mode population and the first lower sideband (SB−) at f_rf − f_g emerge after a common incubation delay that diverges at the scattering threshold and is minimal when the drive is resonant with the m = −1 eigenmode. They interpret this as evidence for a three-wave splitting process |rf⟩(m = −1) → |g⟩(m = +1) + |SB−⟩(m = −2), in which the gyration magnon and a Floquet spin wave are born simultaneously. The central claim is that this splitting is the first-to-occur scattering mechanism in the transient dynamics.

Significance. If the central claim holds, the paper provides the first time-resolved observation of the initial scattering event that leads to a Floquet magnon frequency comb in vortex magnonics. This is a valuable advance over prior steady-state studies (refs. 18–20), and the single-shot electrical method is an experimental strength. The paper also demonstrates that the gyration and the k = −1 Floquet state share a common incubation delay, which is a non-trivial observation. However, the claim relies heavily on separating a real Floquet population from a gyration-induced microwave-mixing component in the transient regime, and this separation is not independently verified. The work is therefore significant but requires additional evidence to be fully convincing.

major comments (2)
  1. [Eq. (1), Fig. 3, Fig. 4(c), Fig. 5] The most load-bearing issue is the transient separation of the real k = −1 Floquet population from the gyration-induced mixing sideband. Equation (1) makes the mixing sideband proportional to the gyration amplitude, so a one-to-one correlation between τ_g and τ_SB- is expected even if SB− is purely a mixing product. The authors argue that the threshold set at 2 dB below the steady-state SB− level lies above the mixing contribution, but this calibration is performed in the steady state using the I_dc = 0 comparison (Fig. 3). It is not verified during the transient. If the gyration amplitude transiently overshoots its steady-state value, or if the time-domain threshold is not exactly equivalent to the frequency-domain ratio, the mixing signal alone could cross the threshold and produce a finite τ_SB- without any real Floquet mode. I recommend the authors provide an independent test in the
  2. [Fig. 5 and τ definitions] The 'common incubation delay' claim rests on a visual linear correlation in Fig. 5, but no correlation coefficient, slope, or error bars are given. Given that τ_g and τ_SB- are extracted from the same noisy time traces, a quantitative correlation analysis (with uncertainties) would strengthen the claim that the two delays are truly shared rather than merely both increasing under similar conditions. Please provide the fit parameters and a discussion of the event-to-event scatter.
minor comments (4)
  1. [Full text, first paragraph] The phrase 'Magnum.npeigenmode simulations' appears to be a typo; 'Magnum.np' is the simulation framework (ref. 27). Also, 'Correlatively' is an unusual but acceptable term; consider 'Consistently' or 'Correspondingly'.
  2. [Fig. 4 caption and text] In the text near Fig. 4(d), the minimum delay is stated to occur at 5.5 GHz, while earlier in the figure caption the device is 300 nm and the m = −1 mode is not explicitly listed. Please state the measured m = −1 frequency for this device and ensure the vertical line in Fig. 4(d) is defined.
  3. [Footnote [31] and Eq. (3)] The spectral-leakage compensation procedure is mentioned only in a footnote. Since it affects the extracted n_SB(t) and hence the threshold crossing, a brief description in the main text or a supplement would improve reproducibility.
  4. [Introduction, refs. 18–20] The reliance on prior work for the Floquet interpretation is acknowledged, but the paper should more explicitly state which aspects of the Floquet assignment are newly established here versus assumed from refs. 18–20. This will help readers judge the independence of the evidence.

Circularity Check

0 steps flagged · score 2.0 of 10

Time-resolved splitting claim is not circular; only minor reliance on authors' prior Floquet-state interpretation.

full rationale

The paper's central new result is a time-resolved measurement: the gyration and lower-sideband populations rise synchronously after a common incubation delay, with the delay diverging at threshold and minimal at the m=-1 resonance. These are raw experimental observations, not outputs of a fit; neither tau_g nor tau_SB- is constructed from the other, and the one-to-one correlation in Fig. 5 is an independent data correlation. Equation (2) is an interpretation of this synchrony via energy and azimuthal conservation, not an identity with the data. The sideband at f_rf - f_g does contain a gyration-mixing contribution (Eq. 1), and the authors explicitly address this by defining tau_SB- with a threshold '2 dB below' the steady-state level and asserting it is 'above the contribution of the sole microwave mixing part' (Fig. 3). Thus the synchrony is not forced by Eq. (1) alone, unless the transient mixing envelope exceeds its steady-state value, which is an experimental assumption rather than a circular construction. The only self-citation is the adoption of the 'Floquet state' interpretation from the authors' prior refs. [18-20] and the m=-2 assignment from their earlier theory. This is somewhat load-bearing for the wording of the conclusion, but the paper also provides independent steady-state evidence (I_dc=0 comparison in Fig. 3) for the reality of the sideband states, and the temporal-splitting claim has clear independent content. Overall, the derivation is self-contained apart from minor self-citation in the interpretive layer.

Assumptions & free parameters 5 free parameters · 6 assumptions · 0 invented entities

The paper's central claim rests on standard micromagnetic and electrical-mixing theory plus the Floquet interpretation inherited from prior work (refs 18-20). No new physical entity is proposed. The main hand-set analysis parameters are the exchange stiffness, the delay thresholds, and the demodulation filter cutoff.

free parameters (5)
  • Exchange stiffness A = 10 pJ/m
    Estimated value used in Magnum.np eigenmode simulations; assigns experimental modes to m=-1 and m=+1 despite ~0.4 GHz mismatch.
  • Gyration incubation threshold (3 dB below steady state) = 3 dB
    Defines τ_g; delay values and the 'minimum at resonance' result depend on this hand-set threshold.
  • SB- incubation threshold (2 dB below steady-state level) = 2 dB below ⟨n_SB-⟩
    Defines τ_SB-; chosen to exceed the mixing-only contribution, but the transient separation of mixing and real Floquet population is not directly verified.
  • I/Q low-pass cutoff = f_g ≈ 0.5 GHz
    Sets demodulation time resolution π/(2f_g) ≈ 3 ns; the claimed 3 ns minimum delay is at this resolution.
  • Spectral-leakage compensation fraction = unspecified ('a fixed fraction')
    Subtracted from Eq. (3) when estimating n_SB(t); the fraction is not reported, so the SB- time traces are not fully reproducible.
assumptions (6)
  • domain assumption Azimuthal number is conserved in three-magnon scattering in vortex-state dots.
    Invoked near Eq. (2) to assign m=-2 to the companion SB- mode; taken from Ref. [8] without re-derivation.
  • domain assumption MTJ resistance is far more sensitive to m=±1 excitations than to other azimuthal indices.
    Used to justify that observed spectral lines correspond to gyration and m=±1 spin waves; depends on device symmetry and current redistribution.
  • domain assumption Magnum.np eigenmode simulations with Ms≈500 kA/m and A=10 pJ/m predict the correct ordering of modes.
    Used to assign experimental 5.49/7.0 GHz modes to m=-1/+1 despite ~0.4-0.45 GHz frequency differences.
  • domain assumption Frequency-comb lines at f_rf+k f_g are Floquet states of a time-periodic gyrating vortex.
    Adopted from refs [18-20] (partly self-authored); central to calling SB- a Floquet spin wave.
  • standard math Equation (1): sideband power is proportional to δR_fluct · I_rf^2.
    Used to distinguish real states from microwave mixing via dc-bias suppression; assumes the electrical mixing model.
  • domain assumption The applied rf field is uniform across the vortex disk and does not actuate the reference layer.
    Used to isolate the vortex-dot response from other magnetic layers in the MTJ.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Time-resolved observation of magnon splitting into vortex gyration and Floquet spin waves." pith.science (2026). https://pith.science/paper/ON6VTCR3

@misc{pith2026251110450,
  author       = {Pith},
  title        = {Pith review of: Time-resolved observation of magnon splitting into vortex gyration and Floquet spin waves},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/ON6VTCR3}},
  note         = {Machine review of arXiv:2511.10450}
}
read the original abstract

Forced excitations at frequencies in the range of the first order azimuthal spin waves of a magnetic disk in the vortex state are known to scatter into the vortex gyration mode, thereby allowing the growth of Floquet spin waves forming a frequency comb. We study the temporal emergence of this dynamical state using time-resolved microwave electrical measurements. The most intense Floquet mode emerges synchronously with the gyration mode after a common incubation delay which diverges at the scattering threshold. This delay is minimal when the drive is resonant with one of the first order azimuthal spin waves. It can be as short as 3 ns for the maximum investigated power. We conclude that the first-to-occur scattering mechanism is the three-wave splitting of a regular azimuthal eigenmode into a coherent pair formed by a gyration magnon and a Floquet spin wave.

Figures

Figures reproduced from arXiv: 2511.10450 by the authors.

Figure 1
Figure 1. FIG. 1. Set-up and effect of the dc and rf drives in the linear [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2. (c) Total power of the gyration mode (defined [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3. Scattering of the forced [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗
Figures from the paper (2 more)
Figure 4
Figure 4. Figure 4: FIG. 4. Time-resolved population of the gyration mode for a [PITH_FULL_IMAGE:figures/full_fig_p004_4.png]
Figure 5
Figure 5. Figure 5: FIG. 5. Correlation between the incubation delays of the gy [PITH_FULL_IMAGE:figures/full_fig_p005_5.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

32 extracted references · 4 linked inside Pith

  1. [1]

    Y/KV2kwRCR5KJM9f2zCX2pY0mYE=

    and as model test bench for micromagnetic theories [2, 3]. Their eigenspectrum comprises a low frequency mode –the translational motion of the vortex core, most often referred to as the gyration mode–, as well as the confined spin wave modes that have frequencies higher by typically more than one order of magnitude [4]. The high frequency modes are conven...

  2. [2]

    H. Yu, J. Xiao, and H. Schultheiss, Magnetic tex- ture based magnonics, Physics Reports Magnetic texture based magnonics,905, 1 (2021)

  3. [3]

    Shinjo, T

    T. Shinjo, T. Okuno, R. Hassdorf, K. Shigeto, and T. Ono, Magnetic Vortex Core Observation in Circular Dots of Permalloy, Science289, 930 (2000)

  4. [4]

    Hertel, S

    R. Hertel, S. Gliga, M. F¨ ahnle, and C. M. Schneider, Ul- trafast Nanomagnetic Toggle Switching of Vortex Cores, 6 Physical Review Letters98, 117201 (2007)

  5. [5]

    Taurel, T

    B. Taurel, T. Valet, V. V. Naletov, N. Vukadinovic, G. de Loubens, and O. Klein, Complete mapping of the spin-wave spectrum in a vortex-state nanodisk, Physical Review B93, 184427 (2016)

  6. [6]

    Schultheiss, R

    K. Schultheiss, R. Verba, F. Wehrmann, K. Wag- ner, L. K¨ orber, T. Hula, T. Hache, A. K´ akay, A. Awad, V. Tiberkevich, A. Slavin, J. Fassbender, and H. Schultheiss, Excitation of Whispering Gallery Magnons in a Magnetic Vortex, Physical Review Letters 122, 097202 (2019)

  7. [7]

    K¨ orber, K

    L. K¨ orber, K. Schultheiss, T. Hula, R. Verba, J. Fassben- der, A. K´ akay, and H. Schultheiss, Nonlocal Stimulation of Three-Magnon Splitting in a Magnetic Vortex, Physi- cal Review Letters125, 207203 (2020)

  8. [8]

    K¨ orber, C

    L. K¨ orber, C. Heins, T. Hula, J.-V. Kim, S. Thlang, H. Schultheiss, J. Fassbender, and K. Schultheiss, Pat- tern recognition in reciprocal space with a magnon- scattering reservoir, Nature Communications14, 3954 (2023)

Show all 32 references
  1. [9]

    Verba, L

    R. Verba, L. K¨ orber, K. Schultheiss, H. Schultheiss, V. Tiberkevich, and A. Slavin, Theory of three-magnon interaction in a vortex-state magnetic nanodot, Physical Review B103, 014413 (2021)

  2. [10]

    J. P. Park and P. A. Crowell, Interactions of Spin Waves with a Magnetic Vortex, Physical Review Letters95, 167201 (2005)

  3. [11]

    K. Y. Guslienko, A. N. Slavin, V. Tiberkevich, and S.- K. Kim, Dynamic Origin of Azimuthal Modes Splitting in Vortex-State Magnetic Dots, Physical Review Letters 101, 247203 (2008)

  4. [12]

    Salama, J.-V

    S. Salama, J.-V. Kim, A. Anane, and J.-P. Adam, Large frequency nonreciprocity of azimuthal spin-wave modes in submicron vortex state disks, Physical Review B111, 134445 (2025)

  5. [13]

    Kammerer, M

    M. Kammerer, M. Weigand, M. Curcic, M. Noske, M. Sproll, A. Vansteenkiste, B. Van Waeyenberge, H. Stoll, G. Woltersdorf, C. H. Back, and G. Schuetz, Magnetic vortex core reversal by excitation of spin waves, Nature Communications2, 279 (2011)

  6. [14]

    Yoo and S.-K

    M.-W. Yoo and S.-K. Kim, Azimuthal-spin-wave-mode- driven vortex-core reversals, Journal of Applied Physics 117, 023904 (2015)

  7. [15]

    Sproll, M

    M. Sproll, M. Noske, H. Bauer, M. Kammerer, A. Gang- war, G. Dieterle, M. Weigand, H. Stoll, G. Woltersdorf, C. H. Back, and G. Sch¨ utz, Low-amplitude magnetic vor- tex core reversal by non-linear interaction between az- imuthal spin waves and the vortex gyromode, Applied Phy...

  8. [16]

    A. S. Jenkins, L. S. E. Alvarez, S. Memshawy, P. Bor- tolotti, V. Cros, P. P. Freitas, and R. Ferreira, Elec- trical characterisation of higher order spin wave modes in vortex-based magnetic tunnel junctions, Communica- tions Physics4, 107 (2021)

  9. [17]

    Z. Gao, F. Wang, X. Zhao, T. Wang, J. Hu, and P. Yan, Interplay between spin wave and magnetic vortex, Phys- ical Review B107, 214418 (2023)

  10. [18]

    Z. Wang, H. Yuan, Y. Cao, and P. Yan, Twisted Magnon Frequency Comb and Penrose Superradiance, Physical Review Letters129, 107203 (2022)

  11. [19]

    Heins, L

    C. Heins, L. K¨ orber, J.-V. Kim, T. Devolder, J. H. Mentink, A. K´ akay, J. Fassbender, K. Schultheiss, and H. Schultheiss, Self-induced Floquet magnons in mag- netic vortices (2024), arXiv:2409.02583 [cond-mat]

  12. [20]

    Heins, A

    C. Heins, A. K´ akay, J.-V. Kim, G. Hlawacek, J. Fass- bender, K. Schultheiss, and H. Schultheiss, Control of magnon frequency combs in magnetic rings (2025), arXiv:2501.05080 [cond-mat]

  13. [21]

    Philippe and J.-V

    G. Philippe and J.-V. Kim, Excitation of vortex core gy- ration in nanopillars through driven Floquet magnons (2025), arXiv:2507.19865 [cond-mat]

  14. [22]

    B. A. Ivanov and C. E. Zaspel, High Frequency Modes in Vortex-State Nanomagnets, Physical Review Letters94, 027205 (2005)

  15. [23]

    Boust and N

    F. Boust and N. Vukadinovic, Micromagnetic simulations of vortex-state excitations in soft magnetic nanostruc- tures, Physical Review B70, 172408 (2004)

  16. [24]

    T. Devolder, Using rf voltage induced ferromagnetic res- onance to study the spin-wave density of states and the Gilbert damping in perpendicularly magnetized disks, Physical Review B96, 104413 (2017)

  17. [25]

    Smith, Modeling of thermal magnetization fluctua- tions in thin-film magnetic devices, Journal of Applied Physics90, 5768 (2001)

    N. Smith, Modeling of thermal magnetization fluctua- tions in thin-film magnetic devices, Journal of Applied Physics90, 5768 (2001)

  18. [26]

    Shreya, A

    S. Shreya, A. S. Jenkins, Y. Rezaeiyan, R. Li, T. B¨ ohnert, L. Benetti, R. Ferreira, F. Moradi, and H. Farkhani, Granular vortex spin-torque nano oscillator for reservoir computing, Scientific Reports13, 16722 (2023)

  19. [27]

    A. S. Jenkins, L. Martins, L. C. Benetti, A. Schulman, P. Anacleto, M. S. Claro, I. Caha, F. L. Deepak, E. Paz, and R. Ferreira, The impact of local pinning sites in mag- netic tunnel junctions with non-homogeneous free layers, Communications Materials5, 7 (2024), publisher: N...

  20. [28]

    Bruckner, S

    F. Bruckner, S. Koraltan, C. Abert, and D. Suess, mag- num.np: a PyTorch based GPU enhanced finite differ- ence micromagnetic simulation framework for high level development and inverse design, Scientific Reports13, 12054 (2023)

  21. [29]

    J. Ding, G. N. Kakazei, X. Liu, K. Y. Guslienko, and A. O. Adeyeye, Higher order vortex gyrotropic modes in circular ferromagnetic nanodots, Scientific Reports4, 4796 (2014)

  22. [30]

    Except whenf rf is directly resonant with the gyration mode, a situation that is not studied here

  23. [31]

    In fact, the rectification ofI rf by a synchronous varia- tion of the device resistance generate a small dc current flowing though the MTJ, which renders the gyration ob- servable in the spectra as a small narrow line at 480 MHz

  24. [32]

    3 leads to some spectral leakage ofn rf into the estimation of the popula- tions for the|k|= 1 modes

    The imperfect selectivity ofF low in Eq. 3 leads to some spectral leakage ofn rf into the estimation of the popula- tions for the|k|= 1 modes. This leakage affectsn SB(t) only during the rise timen rf and can be compensated by systematically subtracting a fixed fraction of dnr...

Pith tools

Reviewed August 3, 2026 · model on record in the stance chip above.