Pith. sign in

REVIEW 3 cited by

SpikingSSMs: Learning Long Sequences with Sparse and Parallel Spiking State Space Models

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2408.14909 v2 pith:OPYUU526 submitted 2024-08-27 cs.CL cs.LGcs.NE

classification cs.CLcs.LGcs.NE
keywords longmodelsspikingdynamicslearningnetworknetworkssequence
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Known as low energy consumption networks, spiking neural networks (SNNs) have gained a lot of attention within the past decades. While SNNs are increasing competitive with artificial neural networks (ANNs) for vision tasks, they are rarely used for long sequence tasks, despite their intrinsic temporal dynamics. In this work, we develop spiking state space models (SpikingSSMs) for long sequence learning by leveraging on the sequence learning abilities of state space models (SSMs). Inspired by dendritic neuron structure, we hierarchically integrate neuronal dynamics with the original SSM block, meanwhile realizing sparse synaptic computation. Furthermore, to solve the conflict of event-driven neuronal dynamics with parallel computing, we propose a light-weight surrogate dynamic network which accurately predicts the after-reset membrane potential and compatible to learnable thresholds, enabling orders of acceleration in training speed compared with conventional iterative methods. On the long range arena benchmark task, SpikingSSM achieves competitive performance to state-of-the-art SSMs meanwhile realizing on average 90\% of network sparsity. On language modeling, our network significantly surpasses existing spiking large language models (spikingLLMs) on the WikiText-103 dataset with only a third of the model size, demonstrating its potential as backbone architecture for low computation cost LLMs.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Efficient Spiking Point Mamba for Point Cloud Analysis

    cs.CV 2025-04 conditional novelty 6.0 of 10

    Spiking Point Mamba combines Mamba state-space layers with spiking neurons and dynamic encoding to achieve state-of-the-art SNN accuracy on point cloud classification and part segmentation.

  2. ASRC-SNN: Adaptive Skip Recurrent Connection Spiking Neural Network

    cs.NE 2025-05 conditional novelty 4.0 of 10

    Skip recurrent connections with per-layer learned spans mitigate gradient vanishing in recurrent spiking neural networks and improve long-sequence classification accuracy.

  3. Revisiting Reset Mechanisms in Spiking Neural Networks for Sequential Modeling: Specialized Discretization for Binary Activated RNN

    cs.NE 2025-04 conditional novelty 4.0 of 10

    A fixed refractory period, implemented as a strided temporal convolution, can replace LIF reset dynamics in a state-space spiking model and still produce sparse, parallel-trainable spikes.

Pith tools