Pith. sign in

REVIEW 6 minor 65 references

A Lorentzian splitting theorem for continuously differentiable metrics and weights

T0 review · 0 major / 6 minor · reviewed 2026-08-06 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read A globally hyperbolic weighted spacetime whose metric and weight are only $C^1$, with distributional timelike Bakry-Emery Ricci bound $\mathrm{Ric}(g,N,V)\geq 0$ and a complete timelike line, must split as $\mathbb{R}\times S$ with…

desk verdict A genuinely new C^1 weighted Lorentzian splitting theorem that deserves serious refereeing, with the main caveat being its reliance on the imported good-approximation lemma. read the letter →

arxiv 2507.06836 v1 pith:V2DD4EP2 submitted 2025-07-09 math.DG gr-qcmath-phmath.APmath.MGmath.MP

Mathias Braun , Nicola Gigli , Robert J. McCann , Argam Ohanyan , Clemens Sämann This is my paper · ORCID
classification math.DGgr-qcmath-phmath.APmath.MGmath.MP MSC 83C7535J9235Q7549Q2251K1053C2153C5058J05
keywords LorentziansplittingtheoremC^1metricsBakry-EmeryRiccitensorBusemannfunctionp-d'Alembertoperatorglobalhyperbolicitytimelikelineweightedspacetimes
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper proves a Lorentzian splitting theorem at low regularity: in a globally hyperbolic spacetime whose metric tensor and weight are only $C^1$, the combination of a distributional Bakry-Emery timelike Ricci lower bound and the existence of one complete timelike line forces the entire spacetime to be a product of a time line and a space manifold. The product structure is witnessed by a $C^2$ isometry $\Phi: \mathbb{R} \times S \to M$ with $g = dt^2 - h$, the weighted measure $e^{-V} \mathrm{vol}_g$ factorizes, and the spatial factor $S$ inherits the same curvature bound one dimension down. This matters because smoothness of the metric is not part of the physical setup: $C^1$ gravitational fields arise naturally from the Einstein equations, and the theorem shows the rigid splitting mechanism survives in that setting. The argument works by showing the Busemann function of the timelike line is $C^2$ with vanishing Hessian, so its gradient is a parallel Killing field whose flow produces the product decomposition.

What carries the argument

The engine is the negative-homogeneity $p$-d'Alembert operator $\Box_p$ for $0 \neq p < 1$, a nonlinear wave operator whose choice of homogeneity makes it elliptic when it acts on functions with timelike gradient; this turns Lorentzian comparison into an elliptic maximum-principle problem. Around it sit two auxiliary objects: the Busemann functions $b_\pm$ of a complete timelike line (limits of distance-to-ray increments) and the $\gamma$-adapted curves, proper-time curves along which $b_+$ and $b_-$ coincide and increase at unit speed, which serve as a stand-in for a timelike co-ray condition. The third pillar is the good approximation lemma, which supplies smooth Lorentzian metrics $g_\varepsilon$ with narrower light cones, converging in $C^1_{\mathrm{loc}}$ to $g$, such that the distributional timelike Ricci bound is preserved uniformly up to an arbitrarily small loss $\delta$; every comparison and limit in the proof passes through this approximation. The local structure statement combines the strong tangency principle with a weighted Bochner-Ohta identity to force $\mathrm{Hess}\, b = 0$ and $dV(\nabla b)=0$, after which $\nabla b$ is a parallel timelike Killing field whose flow exponentiates to the product splitting.

What would settle it

The decisive test is to compute the Hessian of the Busemann function of a complete timelike line in a candidate $C^1$ weighted spacetime satisfying the distributional timelike Bakry-Emery bound. The theorem predicts $\mathrm{Hess}\, b=0$ on a neighbourhood of every $\gamma$-adapted curve; a concrete example with $\mathrm{Hess}\, b \neq 0$ at any point, or with a product neighbourhood that cannot be extended to all of $M$, would refute the claim.

Watch

Extended reading notes

Core claim

The central claim is Theorem 2: if $(M,g)$ is an $n$-dimensional globally hyperbolic spacetime with $C^1$ metric, $V \in C^1(M)$, $N \in [n,\infty)$, the Bakry-Emery condition $\mathrm{Ric}(g,N,V) \geq 0$ holds timelike distributionally, and $\gamma: \mathbb{R} \to M$ is a complete timelike line, then $M$ is isometric to $\mathbb{R} \times S$ with $g = dt^2 - h$ through a $C^2$ bijection $\Phi$, with $\Phi(t,z)=\gamma_t$ for some $z$, with $e^{-V}\mathrm{vol}_g$ splitting as $dt \otimes e^{-V}\mathrm{vol}_h$, and with $(S,h)$ satisfying $\mathrm{Ric}(h,N-1,V)\geq 0$ distributionally. The proof identifies the splitting coordinate with the (common) forward and backward Busemann functions of $\gamma$ and establishes, near every $\gamma$-adapted curve, that it is $p$-harmonic for the negative-homogeneity $p$-d'Alembert operator, hence $C^2$ with vanishing Hessian; a maximal product neighbourhood is then shown to be all of $M$ by a compactness and connectedness argument.

Load-bearing premise

The proof depends on being able to smooth out a $C^1$ spacetime with nonnegative timelike curvature into smooth spacetimes that stay close to it in a strong sense, with the curvature lower bound nearly preserved; if this smoothing step cannot be done, the argument has no way to reach from the rough metric to the smooth comparison estimates.

Editorial extensions

If this is right

  • Any globally hyperbolic $C^1$ weighted spacetime with distributional timelike $\mathrm{Ric}(g,N,V)\geq 0$ and one complete timelike line is globally a time-space product; the splitting is not merely local or asymptotic.
  • The Busemann function of the line is the splitting time coordinate: it is $C^2$ with $|\nabla b|=1$, $\mathrm{Hess}\, b=0$, and $dV(\nabla b)=0$, so the time flow is a parallel Killing flow.
  • The weighted volume measure and the curvature bound both split: $e^{-V}\mathrm{vol}_g = dt \otimes e^{-V}\mathrm{vol}_h$ and $\mathrm{Ric}(h,N-1,V)\geq 0$ distributionally on the spatial factor.
  • If the metric has higher regularity $C^k$ or $C^{k,\alpha}$, the product isometry is correspondingly $C^{k+1}$ or $C^{k+1,\alpha}$.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Our inference: the same $\gamma$-adapted curve technique may remove the timelike co-ray or completeness hypotheses in other splitting problems, replacing them with an existence claim for adapted curves along which the Busemann functions agree.
  • Our inference: the theorem suggests that in any $C^1$ spacetime satisfying the distributional energy condition, a complete timelike line is rigid in the strong sense that all co-rays and asymptotes of the line are tangent to its gradient flow, so no branching of maximal timelike geodesics can occur.
  • Our inference: extending the good approximation lemma to locally Lipschitz metrics, as the paper's outlook proposes, would likely give a splitting theorem for Lorentzian length spaces with synthetic timelike curvature-dimension bounds, using the same $p$-harmonic Busemann function as the splitting coordinate.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

0 major / 6 minor

Summary. The paper proves a weighted Lorentzian splitting theorem for globally hyperbolic spacetimes whose metric tensor and weight are only of regularity C^1. Under a distributional timelike Bakry–Emery Ricci lower bound and the existence of a complete timelike line, the authors show that the spacetime splits isometrically as R times a complete Riemannian manifold, with the weighted measure and the Bakry–Emery curvature condition inherited by the factor. The proof combines the p-d'Alembert technique from the authors' earlier smooth work with a new notion of γ-adapted curves, and it upgrades the splitting map from C^1 to C^2 via an appendix on regularity of semi-Riemannian isometries.

Significance. This is a substantial extension of the classical Lorentzian splitting theorems of Galloway and of Case and Woolgar–Wylie to low-regularity C^1 metrics and weights. The paper is carefully structured: the main chain of arguments—good approximation, equi-superdifferentiability, p-harmonicity of the Busemann function, strong tangency, vanishing Hessian, and globalization by vertical and lateral extension—is carried out in detail, with external results cited explicitly. A particular strength is that the regularity of the splitting map is addressed, including the improvement to C^2 for C^1 metrics. The work also gives a clean framework of line-adapted curves that may be useful beyond this theorem. The main risk is the reliance on the imported good-approximation lemma, but the use of that lemma is consistent throughout and its provenance is clearly stated.

minor comments (6)
  1. [Section 2, Lemma 5] Lemma 5 is the key bridge from the distributional Ricci bound to smooth estimates, and its uniformity is essential for the limit arguments in Sections 5 and 7. Since the proof is not reproduced, the authors should give a precise pointer to the exact statements in [33] and [11] that imply each part of the lemma, especially the uniform timelike Ricci bound on compact sets.
  2. [Section 3, Lemma 8(iii)] In the proof of Lemma 8(iii), the sentence 'To derive a contradiction suppose v_n → 0' is imprecise: one needs to rule out a subsequence converging to zero, and the bounded case with no nonzero cluster point is implicit rather than written out. Rewording this case split would improve readability.
  3. [Section 4, Proposition 13] The reduction 'assume K is covered by a single smooth coordinate chart without loss of generality' should be justified by a finite cover, since a general compact set need not be contained in one chart. The argument is local, so the reduction is harmless, but the wording could be taken literally.
  4. [Section 5, Lemma 16] The extension of Case's K=0 d'Alembert comparison to K ≠ 0 is correct, but the proof would benefit from explicitly stating the Riccati comparison interval and the fact that v(t) = (N-1) cot_{K/(N-1)}(t) solves v' = -K - v^2/(N-1) on its interval of smoothness.
  5. [Section 8, Theorem 24, Claim 2] The inequality ℓ(σ_n_T, γ_t) ≥ sqrt((t-T)^2 - d^2(x_n, γ_0)) is used without comment; it follows from the product formula for time separation in dt^2 - h, but stating this explicitly would make the argument easier to follow.
  6. [Section 7, Proposition 23] The passage from the approximate Bochner–Ohta identity to the limit (35) relies on the convergence □_{p}^{g_ε,V_ε} u_ε → □_{p}^{g,V} u in L^2. This is plausible from C^1 convergence of g_ε, V_ε and W^{2,2} convergence of u_ε, but a brief justification would remove any doubt.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the C^1 weighted splitting theorem is derived through an explicit limiting and p-harmonic argument; cited approximation results are independent inputs, not the conclusion in disguise.

full rationale

I traced the proof from Definition 1 and the assumed complete timelike line through Lemma 5, the equi-superdifferentiability and weak d'Alembert comparison for Busemann limits (Propositions 13-14, 17, Corollary 18), the strong tangency principle (Proposition 20), the Bochner-Ohta vanishing-Hessian step (Proposition 23), and the globalization (Theorem 24, Lemma 25, Theorem 2). The splitting conclusion is never used as an input, and the Bakry-Emery condition is defined independently of the product structure. The principal external ingredient, Lemma 5, is an approximation lemma for C^1 globally hyperbolic metrics with distributional timelike Ricci bounds; it asserts the existence of smooth narrower-cone metrics preserving a uniform lower bound, and it contains no splitting or Busemann-function content. The remark that an impatient reader may take Lemma 5's conclusions as a 'shortcut definition' is expository only; the formal definition remains Definition 1, and the proof uses the lemma as a regularization tool. Citations to the authors' smooth-setting prequel [12] and to [5] supply technique and comparison formulas, not the target theorem; [12] treats smooth metrics and therefore does not already contain the C^1 result. These are dependencies on prior work rather than circular reductions. No fitted parameter is relabeled as a prediction and no known result is merely renamed. Accordingly no circular step is identified.

Assumptions & free parameters 0 free parameters · 5 assumptions · 0 invented entities

The proof introduces no free parameters fitted to data and no new physical entities. It rests on imported background results: the Lorentzian length-space framework, the good approximation lemma for C^1 metrics, the smooth d'Alembert comparison, the strong maximum principle, and the Bochner-Ohta identity. These are listed as axioms. The new gamma-adapted curve notion is a definition used inside the proof, not an independently evidenced entity.

assumptions (5)
  • domain assumption Globally hyperbolic C^1 spacetimes are regularly localizable, K-globally hyperbolic Lorentzian length spaces with upper semicontinuous time separation and compact causal diamonds.
    Invoked in Lemma 7, Lemma 8 and Lemma 9; cited to Samann [52], Kunzinger-Samann [38], Graf [33]. It supplies the compactness and regularity framework on which all subsequent curve arguments rest.
  • domain assumption There exists a good approximation of g by smooth Lorentzian metrics g_epsilon narrower than g with C^1 convergence and preserved distributional timelike Ricci lower bounds in the sense of Lemma 5.
    Lemma 5 is imported from Graf [33] and Braun-Calisti [11]; it is the main bridge from the distributional Ricci condition to the smooth comparison estimates in Sections 5 and 7.
  • standard math Smooth d'Alembert comparison outside the timelike cut locus: under Ric(g,N,V) >= K timelike, the p-d'Alembertian of -ell(.,o) is bounded above by (N-1) cot_{K/(N-1)}(ell(.,o)) outside the past timelike cut locus of o.
    Lemma 16 extends Case [17, Lem. 5.4] from K=0 to general K; the Riccati comparison is standard and supplies the leading term in Proposition 17.
  • standard math Strong maximum principle for uniformly elliptic operators in divergence form with L-infinity coefficients.
    Used in Proposition 20 via Gilbarg-Trudinger [32, Thm. 8.19] to conclude b+ = b- from a nonnegative supersolution that vanishes along a gamma-adapted curve.
  • standard math Weighted Bochner-Ohta identity relating the p-d'Alembertian, the Hessian, and the weighted Ricci curvature.
    Used in Proposition 23 to show the Hessian of the Busemann function vanishes; cited to [12, Lemma 12] and Ohta [49], Bochner [7].

how reviews work

0 comments
Cite this review

Pith. "Pith review of A Lorentzian splitting theorem for continuously differentiable metrics and weights." pith.science (2026). https://pith.science/paper/V2DD4EP2

@misc{pith2026250706836,
  author       = {Pith},
  title        = {Pith review of: A Lorentzian splitting theorem for continuously differentiable metrics and weights},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/V2DD4EP2}},
  note         = {Machine review of arXiv:2507.06836}
}
abstract

We prove a splitting theorem for globally hyperbolic, weighted spacetimes with metrics and weights of regularity $C^1$ by combining elliptic techniques for the negative homogeneity $p$-d'Alembert operator from our recent work in the smooth setting with the concept of line-adapted curves introduced here. Our results extend the Lorentzian splitting theorem proved for smooth globally hyperbolic spacetimes by Galloway -- and variants of its weighted counterparts by Case and Woolgar--Wylie -- to this low regularity setting.

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

65 extracted references · 58 canonical work pages

  1. [12]

    An elliptic proof of the splitting theorems from Lorentzian geometry

    Mathias Braun, Nicola Gigli, Robert J McCann, Argam Ohanyan, and Clemens S¨ amann. An elliptic proof of the splitting theorems from Lorentzian geometry. arXiv:2410.12632, 2024

    arXiv 2024

  2. [1]

    Ambrosio

    L. Ambrosio. Lecture notes on optimal transport problems. In Mathematical Aspects of Evolving Interfaces , volume 1812 of Lecture Notes in Mathematics , pages 1–52. Springer, Berlin, 2003

    work page 2003

  3. [2]

    Bakry and Michel ´Emery

    D. Bakry and Michel ´Emery. Diffusions hypercontractives. In S´ eminaire de probabilit´ es, XIX, 1983/84, volume 1123 of Lecture Notes in Math. , pages 177–206. Springer, Berlin, 1985

    work page 1983

  4. [3]

    Beem, Paul E

    John K. Beem, Paul E. Ehrlich, Steen Markvorsen, and Gregory J. Galloway. Decomposition theorems for Lorentzian manifolds with nonpositive curvature. J. Differential Geom. , 22(1):29–42, 1985

    work page 1985

  5. [4]

    J. J. Benavides Navarro and E. Minguzzi. Global hyperbolicity is stable in the interval topology. J. Math. Phys. , 52(11):112504, 8, 2011

    work page 2011

  6. [5]

    McCann, Argam Ohanyan, Felix Rott, and Clemens S¨ amann

    Tobias Beran, Mathias Braun, Matteo Calisti, Nicola Gigli, Robert J. McCann, Argam Ohanyan, Felix Rott, and Clemens S¨ amann. A nonlinear d’Alembert comparison theorem and causal differential calculus on metric measure space- times. arXiv:2408.15968, 2024

    arXiv 2024

  7. [6]

    Ordinary differential equations

    Garrett Birkhoff and Gian-Carlo Rota. Ordinary differential equations. John Wiley & Sons, Inc., New York, fourth edition, 1989

    work page 1989

  8. [7]

    S. Bochner. Vector fields and Ricci curvature. Bull. Amer. Math. Soc. , 52:776– 797, 1946

    work page 1946

Show all 65 references
  1. [8]

    R´ enyi’s entropy on Lorentzian spaces

    Mathias Braun. R´ enyi’s entropy on Lorentzian spaces. Timelike curvature dimension conditions. J. Math. Pures Appl. , 177(9):46–128, 2023

    2023

  2. [9]

    Exact d’Alembertian for Lorentz distance functions

    Mathias Braun. Exact d’Alembertian for Lorentz distance functions. arXiv:2408.16525, 2024. WEIGHTED C 1-LORENTZIAN SPLITTING THEOREM 41

    2024 arXiv

  3. [10]

    New perspectives on the d’Alembertian from general relativity

    Mathias Braun. New perspectives on the d’Alembertian from general relativity. An invitation. Indag. Math., to appear , 2025

    2025

  4. [11]

    Timelike Ricci bounds for low regularity spacetimes by optimal transport

    Mathias Braun and Matteo Calisti. Timelike Ricci bounds for low regularity spacetimes by optimal transport. Commun. Contemp. Math. , 26(9):Paper No. 2350049, 30, 2024

    2024

  5. [13]

    Caffarelli, M

    L.A. Caffarelli, M. Feldman and R.J. McCann. Constructing optimal maps for Monge’s transport problem as a limit of strictly convex costs. J. Amer. Math. Soc., 15:1–26, 2002

    2002

  6. [14]

    On the smoothness of isometries

    Eugenio Calabi and Philip Hartman. On the smoothness of isometries. Duke Math. J. , 37:741–750, 1970

    1970

  7. [15]

    Hawking’s singularity theorem for Lipschitz Lorentzian metrics

    Matteo Calisti, Melanie Graf, Eduardo Hafemann, Michael Kunzinger, and Roland Steinbauer. Hawking’s singularity theorem for Lipschitz Lorentzian metrics. arXiv:2501.18450, 2025

    2025

  8. [16]

    Splitting theorems for weighted Finsler spacetimes via the p-d’Alembertian: beyond the Berwald case

    Erasmo Caponio, Argam Ohanyan, and Shin-ichi Ohta. Splitting theorems for weighted Finsler spacetimes via the p-d’Alembertian: beyond the Berwald case. arXiv:2412.20783, 2024

    2024 arXiv

  9. [17]

    Jeffrey S. Case. Singularity theorems and the Lorentzian splitting theorem for the Bakry-Emery-Ricci tensor. J. Geom. Phys. , 60:477–490, 2010

    2010

  10. [18]

    On the geometry of synthetic null hypersurfaces

    Fabio Cavalletti, Davide Manini, and Andrea Mondino. On the geometry of synthetic null hypersurfaces. arXiv:2506.04934, 2025

    2025 arXiv

  11. [19]

    Sharp and rigid isoperimetric inequalities in metric-measure spaces with lower Ricci curvature bounds

    Fabio Cavalletti and Andrea Mondino. Sharp and rigid isoperimetric inequalities in metric-measure spaces with lower Ricci curvature bounds. Invent. Math. , 208:803–849, 2017

    2017

  12. [20]

    Optimal transport in Lorentzian syn- thetic spaces, synthetic timelike Ricci curvature lower bounds and applications

    Fabio Cavalletti and Andrea Mondino. Optimal transport in Lorentzian syn- thetic spaces, synthetic timelike Ricci curvature lower bounds and applications. Camb. J. Math. , 12(2):417–534, 2024

    2024

  13. [21]

    The splitting theorem for manifolds of non- negative Ricci curvature

    Jeff Cheeger and Detlef Gromoll. The splitting theorem for manifolds of non- negative Ricci curvature. J. Differential Geometry , 6:119–128, 1971/72

    1971

  14. [22]

    Chru´ sciel and James D

    Piotr T. Chru´ sciel and James D. E. Grant. On Lorentzian causality with continuous metrics. Classical Quantum Gravity , 29(14):145001, 32, 2012

    2012

  15. [23]

    Eschenburg

    J.-H. Eschenburg. The splitting theorem for space-times with strong energy condition. J. Differential Geom. , 27(3):477–491, 1988

    1988

  16. [24]

    Lawrence C. Evans. Partial differential equations, volume 19 of Graduate Studies in Mathematics. American Mathematical Society, Providence, RI, second edition, 2010

    2010

  17. [25]

    Evans and W

    L.C. Evans and W. Gangbo. Differential equations methods for the Monge- Kantorovich mass transfer problem. Mem. Amer. Math. Soc. , 137:1–66, 1999

    1999

  18. [26]

    Feldman and R.J

    M. Feldman and R.J. McCann. Monge’s transport problem on a Riemannian manifold. Trans. Amer. Math. Soc. , 354:1667–1697, 2002

    2002

  19. [27]

    Galloway

    Gregory J. Galloway. The Lorentzian splitting theorem without the completeness assumption. J. Differential Geom. , 29(2):373–387, 1989

    1989

  20. [28]

    Galloway

    Gregory J. Galloway. A note on the Lorentzian splitting theorem. arXiv:2504.05028, 2025

    2025 arXiv

  21. [29]

    Strings and other distributional sources in general relativity

    Robert Geroch and Jennie Traschen. Strings and other distributional sources in general relativity. Phys. Rev. D (3) , 36(4):1017–1031, 1987. 42 BRAUN, GIGLI, MCCANN, OHANYAN, AND S ¨AMANN

    1987

  22. [30]

    An overview of the proof of the splitting theorem in spaces with non-negative Ricci curvature

    Nicola Gigli. An overview of the proof of the splitting theorem in spaces with non-negative Ricci curvature. Anal. Geom. Metr. Spaces , 2:169–213, 2014

    2014

  23. [31]

    The splitting theorem in nonsmooth context

    Nicola Gigli. The splitting theorem in nonsmooth context. Mem. Amer. Math. Soc., to appear

  24. [32]

    Trudinger

    David Gilbarg and Neil S. Trudinger. Elliptic partial differential equations of second order. Classics in Mathematics. Springer-Verlag, Berlin, 2001. Reprint of the 1998 edition

    2001

  25. [33]

    Singularity theorems for C 1-Lorentzian metrics

    Melanie Graf. Singularity theorems for C 1-Lorentzian metrics. Comm. Math. Phys., 378(2):1417–1450, 2020

    2020

  26. [34]

    On isometries and on a theorem of Liouville

    Philip Hartman. On isometries and on a theorem of Liouville. Math. Z., 69:202– 210, 1958

    1958

  27. [35]

    S. W. Hawking. The occurrence of singularities in cosmology. I. Proc. Roy. Soc. Ser. A , 294:511–521, 1966

    1966

  28. [36]

    Needle decompositions in Riemannian geometry

    Bo’az Klartag. Needle decompositions in Riemannian geometry. Mem. Amer. Math. Soc., 249(1180):v+77, 2017

    2017

  29. [37]

    The Hawking-Penrose singularity theorem for C 1-Lorentzian metrics

    Michael Kunzinger, Argam Ohanyan, Benedict Schinnerl, and Roland Stein- bauer. The Hawking-Penrose singularity theorem for C 1-Lorentzian metrics. Comm. Math. Phys. , 391(3):1143–1179, 2022

    2022

  30. [38]

    Lorentzian length spaces.Ann

    Michael Kunzinger and Clemens S¨ amann. Lorentzian length spaces.Ann. Global Anal. Geom., 54(3):399–447, 2018

    2018

  31. [39]

    Michael Kunzinger, Roland Steinbauer, Milena Stojkovi´ c, and James A. Vickers. Hawking’s singularity theorem for C 1,1-metrics. Classical Quantum Gravity , 32(7):075012, 19, 2015

    2015

  32. [40]

    Lorentz meets Lipschitz

    Christian Lange, Alexander Lytchak, and Clemens S¨ amann. Lorentz meets Lipschitz. Adv. Theor. Math. Phys. , 25(8):2141–2170, 2021

    2021

  33. [41]

    LeFloch and Cristinel Mardare

    Philippe G. LeFloch and Cristinel Mardare. Definition and stability of Lorentzian manifolds with distributional curvature. Port. Math. (N.S.) , 64(4):535–573, 2007

    2007

  34. [42]

    Geometry of weighted Lorentz- Finsler manifolds II: A splitting theorem

    Yufeng Lu, Ettore Minguzzi, and Shin-ichi Ohta. Geometry of weighted Lorentz- Finsler manifolds II: A splitting theorem. Internat. J. Math. , 34(1):Paper No. 2350002, 29, 2023

    2023

  35. [43]

    Robert J. McCann. Displacement convexity of Boltzmann’s entropy charac- terizes the strong energy condition from general relativity. Camb. J. Math. , 8(3):609–681, 2020

    2020

  36. [44]

    Robert J. McCann. A synthetic null energy condition. Comm. Math. Phys. , 405(2):Paper No. 38, 24, 2024

    2024

  37. [45]

    Structure theory of metric measure spaces with lower Ricci curvature bounds.J

    Andrea Mondino and Aaron Naber. Structure theory of metric measure spaces with lower Ricci curvature bounds.J. Eur. Math. Soc. (JEMS), 21(6):1809–1854, 2019

    2019

  38. [46]

    An optimal transport formulation of the Einstein equations of general relativity

    Andrea Mondino and Stefan Suhr. An optimal transport formulation of the Einstein equations of general relativity. J. Eur. Math. Soc. (JEMS) , 25(3):933– 994, 2023

    2023

  39. [47]

    Richard P.A.C. Newman. A proof of the splitting conjecture of S.-T. Yau. J. Differential Geom., 31(1):163–184, 1990

    1990

  40. [48]

    The existence of complete Riemannian metrics

    Katsumi Nomizu and Hideki Ozeki. The existence of complete Riemannian metrics. Proc. Amer. Math. Soc. , 12:889–891, 1961

    1961

  41. [49]

    On the curvature and heat flow on Hamiltonian systems

    Shin-Ichi Ohta. On the curvature and heat flow on Hamiltonian systems. Anal. Geom. Metr. Spaces, 2(1):81–114, 2014. WEIGHTED C 1-LORENTZIAN SPLITTING THEOREM 43

    2014

  42. [50]

    Semi-Riemannian geometry, volume 103 of Pure and Applied Mathematics

    Barrett O’Neill. Semi-Riemannian geometry, volume 103 of Pure and Applied Mathematics. Academic Press, Inc. [Harcourt Brace Jovanovich, Publishers], New York, 1983. With applications to relativity

    1983

  43. [51]

    Gravitational collapse and space-time singularities

    Roger Penrose. Gravitational collapse and space-time singularities. Phys. Rev. Lett., 14:57–59, 1965

    1965

  44. [52]

    Global hyperbolicity for spacetimes with continuous metrics

    Clemens S¨ amann. Global hyperbolicity for spacetimes with continuous metrics. Ann. Henri Poincar´ e, 17(6):1429–1455, 2016

    2016

  45. [53]

    A note on the Gannon-Lee theorem

    Benedict Schinnerl and Roland Steinbauer. A note on the Gannon-Lee theorem. Lett. Math. Phys. , 111(6):Paper No. 142, 17, 2021

    2021

  46. [54]

    On the Geroch–Traschen class of metrics

    Roland Steinbauer and James A Vickers. On the Geroch–Traschen class of metrics. Classical and Quantum Gravity , 26(6):065001, 2009

    2009

  47. [55]

    V.N. Sudakov. Geometric problems in the theory of infinite-dimensional proba- bility distributions. Proc. Steklov Inst. Math. , 141:1–178, 1979

    1979

  48. [56]

    Existence and regularity of isometries

    Michael Taylor. Existence and regularity of isometries. Trans. Amer. Math. Soc., 358(6):2415–2423, 2006

    2006

  49. [57]

    Ricci curvature comparison in Riemannian and Lorentzian geometry

    Jan-Hendrik Treude. Ricci curvature comparison in Riemannian and Lorentzian geometry. Master’s thesis, University of Freiburg, 2011. https://freidok. uni-freiburg.de/data/8405

    2011

  50. [58]

    Jan-Hendrik Treude and James D. E. Grant. Volume comparison for hyper- surfaces in Lorentzian manifolds and singularity theorems. Ann. Global Anal. Geom., 43(3):233–251, 2013

    2013

  51. [59]

    Trudinger and X.-J

    N.S. Trudinger and X.-J. Wang. On the Monge mass transfer problem. Calc. Var. Paritial Differential Equations , 13:19–31, 2001

    2001

  52. [60]

    Springer-Verlag, Berlin, 2009

    C´ edric Villani.Optimal transport, Old and New , volume 338 of Grundlehren der mathematischen Wissenschaften [Fundamental Principles of Mathematical Sciences]. Springer-Verlag, Berlin, 2009

    2009

  53. [61]

    Light rays, singularities, and all that

    Edward Witten. Light rays, singularities, and all that. Rev. Modern Phys. , 92(4):045004, 49, 2020

    2020

  54. [62]

    Scalar-tensor gravitation and the Bakry- ´Emery-Ricci tensor

    Eric Woolgar. Scalar-tensor gravitation and the Bakry- ´Emery-Ricci tensor. Classical Quantum Gravity , 30:085007, 8, 2013

    2013

  55. [63]

    Cosmological singularity theorems and split- ting theorems for N -Bakry-´ emery spacetimes.J

    Eric Woolgar and William Wylie. Cosmological singularity theorems and split- ting theorems for N -Bakry-´ emery spacetimes.J. Math. Phys. , 57(2):022504, 12, 2016

    2016

  56. [64]

    Curvature-dimension bounds for Lorentzian splitting theorems

    Eric Woolgar and William Wylie. Curvature-dimension bounds for Lorentzian splitting theorems. J. Geom. Phys. , 132:131–145, 2018

    2018

  57. [65]

    Problem section

    Shing Tung Yau. Problem section. In Seminar on Differential Geometry , Ann. of Math. Stud., No. 102, pages 669–706. Princeton Univ. Press, Princeton, NJ, 1982. 44 BRAUN, GIGLI, MCCANN, OHANYAN, AND S ¨AMANN Institute of Mathematics, EPFL, 1015 Lausanne, Switzerlandmathias. bra...

    1982

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.