Pith. sign in

REVIEW 1 cited by

MPI-AMRVAC: a parallel, grid-adaptive PDE toolkit

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2004.03275 v1 pith:6TYBW3RD submitted 2020-04-07 astro-ph.IM physics.comp-ph

classification astro-ph.IMphysics.comp-ph
keywords applicationsmpi-amrvacparalleldynamicsequationsherepdesplasma
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

We report on the latest additions to our open-source, block-grid adaptive framework MPI-AMRVAC, which is a general toolkit for especially hyperbolic/parabolic partial differential equations (PDEs). Applications traditionally focused on shock-dominated, magnetized plasma dynamics described by either Newtonian or special relativistic (magneto)hydrodynamics, but its versatile design easily extends to different PDE systems. Here, we demonstrate applications covering any-dimensional scalar to system PDEs, with e.g. Korteweg-de Vries solutions generalizing early findings on soliton behaviour, shallow water applications in round or square pools, hydrodynamic convergence tests as well as challenging computational fluid and plasma dynamics applications. The recent addition of a parallel multigrid solver opens up new avenues where also elliptic constraints or stiff source terms play a central role. This is illustrated here by solving several multi-dimensional reaction-diffusion-type equations. We document the minimal requirements for adding a new physics module governed by any nonlinear PDE system, such that it can directly benefit from the code flexibility in combining various temporal and spatial discretisation schemes. Distributed through GitHub, MPI-AMRVAC can be used to perform 1D, 1.5D, 2D, 2.5D or 3D simulations in Cartesian, cylindrical or spherical coordinate systems, using parallel domain-decomposition, or exploiting fully dynamic block quadtree-octree grids.

Discussion (0). Sign in to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Impact of rotation on magnetic field stability and orientation in isolated neutron stars

    astro-ph.HE 2025-08 conditional novelty 5.0 of 10

    In 3D GRMHD simulations, neutron star rotation delays Tayler, kink, and Parker instabilities, so faster-spinning models retain more magnetic energy over 10 Alfven times.

Pith tools