Pith

open record

sign in

arxiv: 2012.02328 · v4 · pith:EKW5UW2G · submitted 2020-12-03 · cs.LG · cs.DC

MLPerf Mobile Inference Benchmark

Reviewed by Pith T0 review T1 audit T2 compute T3 formal T4 reserved pith:EKW5UW2Grecord.jsonopen to challenge →

classification cs.LG cs.DC
keywords mobilebenchmarkdatadevicesdifferentfirstmlperfmodels
0
0 comments X
read the original abstract

This paper presents the first industry-standard open-source machine learning (ML) benchmark to allow perfor mance and accuracy evaluation of mobile devices with different AI chips and software stacks. The benchmark draws from the expertise of leading mobile-SoC vendors, ML-framework providers, and model producers. It comprises a suite of models that operate with standard data sets, quality metrics and run rules. We describe the design and implementation of this domain-specific ML benchmark. The current benchmark version comes as a mobile app for different computer vision and natural language processing tasks. The benchmark also supports non-smartphone devices, such as laptops and mobile PCs. Benchmark results from the first two rounds reveal the overwhelming complexity of the underlying mobile ML system stack, emphasizing the need for transparency in mobile ML performance analysis. The results also show that the strides being made all through the ML stack improve performance. Within six months, offline throughput improved by 3x, while latency reduced by as much as 12x. ML is an evolving field with changing use cases, models, data sets and quality targets. MLPerf Mobile will evolve and serve as an open-source community framework to guide research and innovation for mobile AI.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. When NPUs Are Not Always Faster: A Stage-Level Analysis of Mobile LLM Inference

    cs.AR 2026-05 unverdicted novelty 6.0

    Stage-level profiling on mobile SoC finds CPUs faster than NPUs in prefill (up to 1.6x) and only modest NPU gains in decode (1.05-1.2x), plus rising energy with greater NPU offload.