Pith. sign in

REVIEW 1 cited by

Endpoint Symmetries of Helicity Amplitudes

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1309.7802 v2 pith:M2AJ3FBR submitted 2013-09-30 hep-ph hep-ex

Endpoint Symmetries of Helicity Amplitudes

classification hep-ph hep-ex
keywords endpointamplitudescasedecaysfindingshelicitykinematicpower
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
abstract

We investigate helicity amplitudes (HAs) of $A \to B C$-type decays for arbitrary spin towards the kinematic endpoint. We show that they are proportional to product of Clebsch-Gordan coefficients (CGC) and the velocity to some positive power. The latter can be zero in which case the HA is non-vanishing at the endpoint. In essence the spatial rotational symmetry, broken by the relative spatial momenta of the particles, is restored at the kinematic endpoint. Therefore SO(3) and SU(2), for bosons and fermion in the decay, act like a global internal symmetry groups. Some of our results can be understood in terms of the Wigner- Eckart theorem. The findings are useful for i) checking theoretical computations and ii) the case where there is a sequence of decays, say $B \to B_1B_2$ with the pair $(B_1B_2)$ not interacting (significantly) with the $C$-particle. An example is $H \to Z Z^* \to 4\ell$ where our findings might be of use for experimentally determining the Higgs quantum numbers. Angular observables, which are essentially ratios of HAs, are given by ratios of CGC at the endpoint. We briefly discuss power corrections in the velocity to the leading order.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Investigation of $\Lambda_{b}\to \Lambda_{c} \ell^-\overline\nu_\ell$ Decays in Perturbative QCD Approach

    hep-ph 2025-09 conditional novelty 6.0

    A leading-order pQCD calculation of all six Lambda_b to Lambda_c form factors, z-expanded and anchored to a lattice QCD point, predicts R_Lambda_c = 0.29+0.12-0.11, slightly above LHCb.