Pith. sign in

REVIEW 3 cited by

Asymmetry in Low-Rank Adapters of Foundation Models

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2402.16842 v2 pith:SPXDELWA submitted 2024-02-26 cs.LG

Asymmetry in Low-Rank Adapters of Foundation Models

classification cs.LG
keywords fine-tuninglow-rankmatricesadaptersasymmetryboundeffectivefeatures
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Parameter-efficient fine-tuning optimizes large, pre-trained foundation models by updating a subset of parameters; in this class, Low-Rank Adaptation (LoRA) is particularly effective. Inspired by an effort to investigate the different roles of LoRA matrices during fine-tuning, this paper characterizes and leverages unexpected asymmetry in the importance of low-rank adapter matrices. Specifically, when updating the parameter matrices of a neural network by adding a product $BA$, we observe that the $B$ and $A$ matrices have distinct functions: $A$ extracts features from the input, while $B$ uses these features to create the desired output. Based on this observation, we demonstrate that fine-tuning $B$ is inherently more effective than fine-tuning $A$, and that a random untrained $A$ should perform nearly as well as a fine-tuned one. Using an information-theoretic lens, we also bound the generalization of low-rank adapters, showing that the parameter savings of exclusively training $B$ improves the bound. We support our conclusions with experiments on RoBERTa, BART-Large, LLaMA-2, and ViTs.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. TLoRA: Task-aware Low Rank Adaptation of Large Language Models

    cs.CL 2026-04 unverdicted novelty 6.0

    TLoRA jointly optimizes LoRA initialization via task-data SVD and sensitivity-driven rank allocation, delivering stronger results than standard LoRA across NLU, reasoning, math, code, and chat tasks while using fewer ...

  2. Task-agnostic Low-rank Residual Adaptation for Efficient Federated Continual Fine-Tuning

    cs.LG 2025-05 unverdicted novelty 6.0

    Fed-TaLoRA uses task-agnostic low-rank residual adaptation with post-aggregation calibration to enable efficient federated continual fine-tuning across sequential tasks under non-IID conditions.

  3. Continual Knowledge Consolidation LORA for Domain Incremental Learning

    cs.LG 2025-10 conditional novelty 5.0

    CONEC-LoRA reports state-of-the-art accuracy on four domain-incremental benchmarks by combining task-shared and task-specific LoRAs with a stochastic classifier and a learned domain-ID selector.