Pith. sign in

REVIEW 3 cited by

Information Leakage from Embedding in Large Language Models

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2405.11916 v3 pith:YA3EYCG6 submitted 2024-05-20 cs.LG cs.CR

classification cs.LGcs.CR
keywords embeddingsprivacylayersattackingdataembedembeddinghidden
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

The widespread adoption of large language models (LLMs) has raised concerns regarding data privacy. This study aims to investigate the potential for privacy invasion through input reconstruction attacks, in which a malicious model provider could potentially recover user inputs from embeddings. We first propose two base methods to reconstruct original texts from a model's hidden states. We find that these two methods are effective in attacking the embeddings from shallow layers, but their effectiveness decreases when attacking embeddings from deeper layers. To address this issue, we then present Embed Parrot, a Transformer-based method, to reconstruct input from embeddings in deep layers. Our analysis reveals that Embed Parrot effectively reconstructs original inputs from the hidden states of ChatGLM-6B and Llama2-7B, showcasing stable performance across various token lengths and data distributions. To mitigate the risk of privacy breaches, we introduce a defense mechanism to deter exploitation of the embedding reconstruction process. Our findings emphasize the importance of safeguarding user privacy in distributed learning systems and contribute valuable insights to enhance the security protocols within such environments.

Discussion (0). Sign in to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. When Latent Agents Lie: KV-Cache Integrity in Multi-Agent LLM Collaboration

    cs.MA 2026-06 conditional novelty 7.0 of 10

    KV-cache sharing boosts multi-agent QA performance but enables undetectable tampering; HMAC manifests binding agent, session, and payload reliably detect changes.

  2. RouteScan: A Non-Intrusive Approach to Auditing MoE LLMs Safety via Expert Routing Telemetry

    cs.CR 2026-05 unverdicted novelty 6.0 of 10

    RouteScan identifies malicious prompts in MoE LLMs using GPU expert routing telemetry as a privacy-preserving fingerprint, achieving AUROC above 0.93 on unseen harmful domains.

  3. Cascade: Token-Sharded Private LLM Inference

    cs.LG 2025-07 conditional novelty 6.0 of 10

    Cascade performs LLM inference by sharding the token sequence across non-colluding nodes, claiming resistance to vocabulary-matching and learning-based reconstruction attacks while being orders of magnitude faster than SMPC.

Pith tools