Birefringence in fermion-attenuated gravitational wave power spectrum

Antonino Marciano; Jinglong Liu; Stephon Alexander

REVIEW 5 major objections 5 minor 67 references

Birefringence in fermion-attenuated gravitational wave power spectrum

T0 review · 5 major / 5 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read Fermion-damped gravitational-wave spectra in Chern-Simons gravity become chiral, with peaks and dips positioned by the inflaton mass and sized by the Chern-Simons coupling, a pattern testable by LISA, Taiji, and Tianqin.

desk verdict A plausible new combination of known ingredients—CS birefringence plus fermion damping—with a qualitative chiral peak/dip pattern that is worth one round of referee attention, mainly on the factor-of-2 error and the unjustified resonance condition. read the letter →

arxiv 2501.08240 v1 pith:HHSG4CKA submitted 2025-01-14 gr-qc astro-ph.COhep-phhep-th

Jinglong Liu , Stephon Alexander , Antonino Marciano This is my paper · ORCID

classification gr-qcastro-ph.COhep-phhep-th PACS 04.30.-w04.50.Kd98.80.Cq

keywords stochasticgravitationalwavesChern-Simonsgravitybirefringencewavedampingdarkfermionsinflatonreheatingparametricresonance

verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper argues that combining Chern-Simons gravity, which violates parity in the gravitational sector, with the damping of gravitational waves by self-interacting relativistic fermions produces a measurable chiral fingerprint in the stochastic gravitational-wave background. The right- and left-handed circular polarization spectra develop oscillatory peaks and dips whose positions are set by the ratio $m_\phi a/k$, determined by the inflaton mass, and whose amplitudes are set by the Chern-Simons coupling. The authors solve the coupled gravitational-wave and Boltzmann equations numerically and find birefringence, a small amplitude difference between the two chiralities, together with a total spectrum that still shows the oscillatory features. They predict that this pattern is falsifiable and within reach of the next space-borne interferometers LISA, Taiji, and Tianqin, and would provide a way to test Chern-Simons gravity and constrain inflation and reheating.

What carries the argument

The central object is the pair of coupled evolution equations for the circular polarization amplitudes $h_R$ and $h_L$, in which the Chern-Simons term enters as a helicity-dependent damping coefficient $\Theta = (2\alpha/M_{\rm Pl}^2 a^2)(\phi'' - 2\mathcal{H}\phi')$, together with the Boltzmann hierarchy for the fermion distribution functions whose tensor moments source the anisotropic stress. The analytical control comes from the resonance condition $2\alpha\phi_0 m_\phi/M_{\rm Pl}^2 \sim m_\phi a/k$, which fixes where the parametric-resonance peaks and dips appear in the spectrum as a function of frequency. This condition links observable features directly to the inflaton mass and the Chern-Simons coupling.

What would settle it

Use LISA, Taiji, or Tianqin to measure the stochastic gravitational-wave background in the band where the model predicts oscillatory peaks and dips: for a fixed Chern-Simons coupling, the dip and peak positions are determined by $m_\phi a/k$, and the amplitudes by $2\alpha H m_\phi/M_{\rm Pl}$. A null detection of this chiral pattern at the predicted frequencies and amplitudes, with the assumed $\Omega_\nu = 1/20$, would rule out the combined scenario, as would a measurement showing no difference between right- and left-handed spectra once polarization sensitivity becomes available.

Watch

Extended reading notes

Core claim

Within dynamical Chern-Simons gravity, where a pseudoscalar inflaton couples to the gravitational Pontryagin density, the propagation equations for right- and left-handed gravitational waves acquire opposite-sign damping terms proportional to $\Theta$. When the anisotropic stress from self-interacting relativistic fermions is added through the Boltzmann hierarchy, the two chiral components of the power spectrum no longer coincide: they show peaks and dips whose locations track $m_\phi a/k$ and whose size is controlled by the Chern-Simons prefactor. The pattern arises from gravitationally mediated parametric resonance during reheating, with the inflaton transferring energy preferentially to right-handed waves and away from left-handed waves. The authors compute this for both inflationary modes re-entering the horizon during reheating and causal sources such as phase transitions, and find that even the chirality-averaged spectrum retains the oscillatory signal, which is why the authors argue LISA, Taiji, or Tianqin could observe it without polarization sensitivity.

Load-bearing premise

The calculation assumes that during reheating there exists a population of self-interacting dark fermions or sterile neutrinos, with energy fraction $\Omega_\nu = 1/20$ and interaction index $n = 5$, whose damping of gravitational waves is strong enough, while no specific particle model or mass is supplied. If no such particles exist with that abundance and interaction behavior, the combined birefringent signal does not occur.

Editorial extensions

If this is right

If the prediction holds, the chirality-averaged stochastic gravitational-wave spectrum is enough to search for the signal, since the peaks and dips survive summing over polarizations.
Observing the oscillatory pattern would constrain the inflaton mass through the peak and dip positions and the Chern-Simons coupling through their amplitudes, giving a direct handle on the inflationary and reheating epochs.
The same resonance features appear for causal gravitational waves generated by phase transitions or resonant particle production, so the test is not tied to a particular source.
The difference between right- and left-handed spectra implies a net transfer of energy from the inflaton to right-handed gravitational waves, which could be tied to a chiral asymmetry in the fermion sector.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

The paper leaves open a sharp particle-physics target: a concrete dark-fermion model fixing the mass, abundance, and self-interaction strength would turn the benchmark values $\Omega_\nu = 1/20$ and $n = 5$ into definite predictions that can be checked or excluded.
If the birefringent pattern is seen, it would also strengthen the case that Chern-Simons gravity can emerge from an effective theory of self-interacting fermions, since the same fermions would be responsible for both the damping and the parity-violating gravitational coupling.
One testable extension is to look for chirality-dependent astrometric deflections of distant sources by the stochastic background; the paper notes this as a potential channel, and a detection there would corroborate the spectrum-level prediction.
Another extension would be to compute the predicted signal using the standard-model neutrino fraction instead of the dark-fermion benchmark, to see whether any residual birefringence survives with known particles.

Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Desk Editor's Note

read the letter

The genuinely new thing here is the combination: CS birefringence and fermion damping are each known, but this is the first calculation putting them together and showing chiral peaks and dips in the damped GW power spectrum. That is a legitimate extension, not a paradigm shift. The numerical method is also careful—Boltzmann hierarchy to l_max=100, iterative solving, stated tolerances—and the qualitative birefringence is expected.

Now the soft spots, in rough order of seriousness.

First, there is a factor-of-2 mismatch between Eq. (12) and Eqs. (13)–(15). Moving from position to momentum space changes 4α to 2α without explanation. It is a small numerical factor, but it changes the effective CS coupling by 2 and should be fixed.

Second, Eq. (41) is presented as the resonance condition without derivation. The stress-test note is partly right: equating the prefactor to the oscillation frequency is not the standard Mathieu/Floquet condition, which is m_phi a/k ~ constant (e.g., 2). I checked, though, and the qualitative m_phi dependence of the peak/dip positions survives either way because both conditions give k ∝ m_phi. So the central trend is not destroyed, but the quantitative positions are not established until the condition is replaced by the correct parametric-resonance criterion.

Third, the collision coefficients alpha_l in Eq. (28) are never specified, so the calculation is not reproducible from the text alone. That is a real gap for a numerical paper.

Fourth, the dark-fermion sector is a placeholder: Omega_nu=1/20 and n=5 are chosen by fiat, with no particle model, and the LISA/Taiji/Tianqin observability claim is not backed by any sensitivity estimate—only a normalized ratio is plotted. The abstract also has a typo, “chiral independent,” which should be “chiral dependent.”

None of these is fatal. The core combination is valid, the numerics are plausible, and the authors are candid about some limitations (e.g., no precise Omega_nu). My recommendation: send this to a serious referee. The paper deserves referee time, but the referee should insist on fixing the factor of 2, deriving or replacing Eq. (41) with the proper resonance condition, and specifying alpha_l before acceptance. I would not personally cite it yet in its current form, but I would read the revised version.

Referee Report

5 major / 5 minor

Summary. The paper studies the propagation of primordial and causal gravitational waves in dynamical Chern-Simons gravity, adding a damping term from self-interacting relativistic fermions modeled through a Boltzmann hierarchy. It derives helicity-dependent equations of motion for the left- and right-handed GW amplitudes, solves them numerically, and reports a small birefringence in the power spectrum together with oscillatory peaks and dips in the ratio \Omega_GW/\Omega_GW[ffs=0]. These features are attributed to inflaton-mediated parametric resonance during reheating. The paper claims that the peaks/dips have positions set by the inflaton mass through the combination m_phi a/k, amplitudes set by the Chern-Simons prefactor, and that this pattern is in principle observable by LISA, Taiji, and Tianqin.

Significance. If the advertised prediction were established, this would provide a new, falsifiable probe of Chern-Simons gravity and of the reheating epoch, and it would connect parity violation in the gravitational sector with dark-fermion damping of stochastic GW backgrounds. The paper builds on standard ingredients: the Chern-Simons GW equations from prior literature, the Boltzmann hierarchy for fermionic anisotropic stress, and a numerical integration scheme with explicitly stated tolerances. It is not circular in the sense that the main numerical result follows from solving equations taken from earlier work. However, several load-bearing steps in the derivation and interpretation are not currently justified, so the quantitative prediction — especially the parametric-resonance condition and the observability claim — is not yet reliable.

major comments (5)

[Sec. 2, Eqs. (12)-(15)] There is an apparent factor-of-2 mismatch between the position-space equation and the momentum-space equation. Fourier transforming Eq. (12) with \partial_z \to i k turns the Chern-Simons term into \mp 4\alpha/(a^2 M_pl^2)\,(\phi''-2{\cal H}\phi')\, k\, h'_{R/L}, which means Eqs. (13)-(14) require \Theta = 4\alpha/(M_pl^2 a^2)(\phi''-2{\cal H}\phi'), not the expression with a factor 2 given in Eq. (15). Unless a different helicity or derivative convention is intended and stated, the numerical value of \Theta is a factor of 2 too small, which changes the inferred Chern-Simons coupling and the amplitudes of the peaks/dips.
[Sec. 4, Eq. (38)] The derivation of \Theta from the approximate inflaton profile is not shown and appears to involve unjustified substitutions. With \phi \approx \phi_0 \sin(m_\phi a\tau) and \phi_0 = M_pl/(m_\phi a\tau), the leading oscillatory term in \Theta = 2\alpha/(M_pl^2 a^2)(\phi''-2{\cal H}\phi') is proportional to -2\alpha m_\phi^2\phi_0/M_pl^2 \sin(m_\phi a\tau) = -2\alpha m_\phi/(M_pl a\tau)\sin(...), not -2\alpha {\cal H}m_\phi/M_pl \sin(...), unless one assumes {\cal H}=1/(a\tau). For the conformal Hubble parameter {\cal H}=a'/a in a radiation-dominated universe one has {\cal H}=1/\tau, so a\tau is not equal to 1/{\cal H} in general. The second term in Eq. (38) similarly requires an additional relation between \phi_0, a, and {\cal H}. Since Eq. (39) is the equation actually integrated, the missing factors directly affect the parametric-resonance amplitude and the numerical spectra.
[Sec. 4, Eq. (41)] The resonance condition used to explain the peaks and dips is not consistent with the equation being solved and is dimensionally unbalanced. Eq. (39) contains a time-periodic damping term with dimensionless argument \omega x, where \omega = m_\phi a/k. Parametric resonance for this system is a Mathieu/Floquet-type condition, typically \omega \approx 2/n at leading order, not an equality between the oscillation prefactor 2\alpha {\cal H}m_\phi/M_pl and \omega. Moreover, Eq. (41), 2\alpha\phi_0 m_\phi/M_pl^2 \sim m_\phi a/k, has incompatible dimensions in natural units: the left side has dimension of inverse mass while the right side is dimensionless. Substituting \phi_0 = M_pl/(m_\phi a\tau) makes the left side independent of m_\phi, so the claimed derivation that increasing m_\phi shifts peaks to larger k is not established. The scaling k \propto m_\phi may still follow from \omega \approx const, but the paper's specific criterion and its prefactor dependence need to be corrected.
[Sec. 3, Eq. (28)] The numerical coefficients \alpha_l in the collision term C_{\lambda,l} = \alpha_l \,\partial_\tau\kappa_\nu F_{\lambda,l} are never specified. Since the damping from self-interacting fermions is a central ingredient of the calculation, the numerical solution is not reproducible without these values. Please state the values used for each l (or the explicit expression from Refs. [42,44]), and also comment on whether the truncation at l_max=100 with the closure condition (34) was checked for convergence.
[Sec. 5, final paragraph] The observability claim for LISA, Taiji, and Tianqin is not supported by the analysis presented. The figures plot \Omega_GW/\Omega_GW[ffs=0] as a function of k/k_* or k\tau_i, with no conversion to physical frequency, no assumed reheating scale, no detector sensitivity curves, and no signal-to-noise estimate. A benchmark parameter set that maps the abscissa to Hz and compares the predicted total power spectrum with projected sensitivities is needed before it can be stated that the peaks and dips are observable.

minor comments (5)

[Abstract and text] There are numerous typographical and grammatical errors, e.g. 'is expressed terms', 'dumping effect', and 'in the ones not accounting for an anisotropic stress-energy tensor'; these should be corrected throughout.
[Sec. 4, Eq. (39) context] The text says that both sides of Eqs. (13)-(14) are divided by k^2, but Eq. (39) retains k-dependent terms with the prefactor written as 2\alpha {\cal H}m_\phi/M_pl; please clarify the normalization and the definition of x.
[Figs. 1 and 2] The figures are difficult to read: axis labels, line styles, and parameter values should be stated clearly in the captions, and the plotted ratio and normalization should be defined in the caption.
[Sec. 4.2] There is a typo 'inflationary caseRef.' in the text; also, the choice \tau_i/\tau_\star = 1 is made 'for convenience' without discussion of how relaxing it would affect the results.
[Sec. 4, parameter choice] The benchmark values \Omega_\nu=1/20 and n=5 are acknowledged as phenomenological choices, but a short comment on the implied self-interaction strength or possible constraints on such dark fermions would help the reader assess the naturalness of the assumed damping.

Circularity Check

1 steps flagged · score 4.0 of 10

The numerical birefringence result is self-contained, but the peak/dip position prediction rests on a resonance criterion (Eq. 41) imported from the authors' own Ref. [23], and that criterion does not follow from the equation actually integrated (Eq. 39).

ansatz smuggled in via citation [Sec. 4.1, paragraph following Eq. (41)]
"Following the arguments in Ref. [23], the phenomenon occurs when the oscillatory damping of the GWs' amplitude, induced by the CS term proportional to Θ, becomes comparable to the oscillation rate of the inflaton. In this context, the inflaton transfers energy to the GWs, mediating the energy transfer to the matter field. This requires 2αϕ0mϕ/M2pl ∼ mϕa/k, (41), as indicated by the dips and peaks in Fig. (1)."

The paper's quantitative claim that peak/dip positions scale with mϕ a/k is not derived from the equation it solves. In the integrated Eq. (39) the CS damping amplitude is 2αHmϕ/Mpl, whereas Eq. (41), taken from Ref. [23] (which shares two authors with the present paper), compares 2αϕ0mϕ/M2pl to mϕa/k. Substituting the paper's own envelope ϕ0 = Mpl/(mϕaτ) makes the left side of Eq. (41) equal to 2α/(aτMpl), which contains no mϕ factor and is not the coefficient appearing in Eq. (39); equating it to mϕa/k would cancel the mϕ dependence, undermining the claimed shift. The mϕ-dependent prediction therefore reduces to an unverified resonance condition imported from the authors' prior work rather than following from the model integrated here.

full rationale

Most of the derivation chain is not circular. Equations (13)-(15), (37)-(39) are the standard CS gravity evolution equations assembled from the cited literature, and the fermion damping is imported from Refs. [42,44] and solved numerically with initial conditions (40)/(42). The chiral power spectra in Figs. 1-2 are genuine numerical outputs of the coupled system, not fits to a predetermined answer, and the chosen values Θ = 10^-2, Ων = 1/20, n = 5 are stated as convenient reference values rather than extracted from the target spectra. The one load-bearing self-citation is the parametric-resonance criterion (41), which the paper takes from Ref. [23] by the same research group and then uses to explain and predict the mϕ-dependent positions of the peaks/dips. Because (41) is not re-derived in this paper and, with the paper's own envelope ϕ0 = Mpl/(mϕaτ), is not consistent with the prefactor appearing in Eq. (39), the mϕ scaling of the features rests on the imported criterion rather than on the integrated model. That is a circularity-relevant reliance on a self-citation, though the core birefringence signal itself is an independent numerical result. Additional issues such as the factor-2 mismatch between the 4α coefficient in Eq. (12) and Θ in Eq. (13), and the apparent inconsistency of Eq. (41) with Eq. (39), are correctness risks rather than circularity and are noted here for completeness.

Assumptions & free parameters 5 free parameters · 5 assumptions · 1 invented entities

The central claim rests on the Chern-Simons framework, an approximate oscillating-inflaton solution, a truncated Boltzmann hierarchy, a parametric-resonance condition borrowed from the authors' prior work, and an unspecified dark-fermion sector. The free parameters Theta, Omega_nu, n, m_phi a/k, and tau_i/tau_star are chosen by hand or varied for display, so the quantitative predictions are not parameter-free.

free parameters (5)

Chern-Simons prefactor Theta = |Theta| = 10^-2 (magnitude)
Set for numerical convenience in Sec. 4; controls the amplitude of birefringence and of the peaks and dips but is not derived from alpha and m_phi.
Dark fermion energy fraction Omega_nu = 1/20
Reference value chosen for comparison with Ref. [42]; no particle model determines it (Sec. 4).
Fermion interaction index n = n = 5 (decoupled) and n < 2 (re-coupling)
Phenomenological parameter in the optical depth model, Eqs. (29)-(33); only these two branches are shown.
Inflaton mass-to-mode ratio m_phi a/k_star (or m_phi a tau_i) = varied across figures, e.g. 10^-2, 1, 10^2
Sets the positions of peaks and dips; m_phi is not fixed by an independent constraint.
Causal GW time ratio tau_i/tau_star = 1
Chosen for convenience in Sec. 4.2; not varied even though the paper claims generality.

assumptions (5)

domain assumption Chern-Simons gravity action and field equations (Eqs. 1-7) are the correct low-energy model for parity-violating gravity.
Framework assumed from Refs. [19,20]; central claim only meaningful within this theory.
domain assumption The inflaton is a quadratic-potential oscillating scalar with phi(tau) approximately phi0 sin(m_phi a tau), phi0 = M_pl/(m_phi a tau), and m_phi a >> H during reheating so the cos term in Theta can be dropped.
Used in Sec. 4, Eqs. (37)-(39), to reduce the Chern-Simons source to a single oscillatory term; approximate.
domain assumption Boltzmann hierarchy truncation at l_max=100 with closure Eq. (34) and five iterations is accurate.
No convergence proof or code is provided; statement in Sec. 4.
ad hoc to paper The parametric resonance condition Eq. (41) from Ref. [23] explains the numerical peaks and dips.
Invoked from the authors' prior paper to interpret the oscillations; not derived here.
domain assumption The fermion anisotropic stress formula Eq. (26) and collision term Eq. (28) from Refs. [42,44] apply to the hypothetical dark fermions.
The coefficients alpha_l are not listed, so the re-coupling runs cannot be independently checked.

invented entities (1)

Self-interacting dark fermions (or sterile neutrinos)
purpose: Provide the gravitational wave damping during reheating, since standard-model neutrinos decoupled too early to damp these modes (Sec. 4).
No mass, coupling, or detection channel is specified; only an energy fraction Omega_nu = 1/20 is chosen ad hoc. The paper says a detection could later constrain their masses, so there is no independent falsifiable handle now.

how reviews work

0 comments

Cite this review

Pith. "Pith review of Birefringence in fermion-attenuated gravitational wave power spectrum." pith.science (2026). https://pith.science/paper/HHSG4CKA

@misc{pith2026250108240,
  author       = {Pith},
  title        = {Pith review of: Birefringence in fermion-attenuated gravitational wave power spectrum},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/HHSG4CKA}},
  note         = {Machine review of arXiv:2501.08240}
}

read the original abstract

Within the framework of Chern-Simons gravity, a theory that dynamically violates parity, we analyze the power spectrum of gravitational waves in light of the damping effect due to the free streaming relativistic neutrinos and dark fermions. The power spectrum is expressed terms of right- and left-handed polarizations, and the evolution of the gravitational waves is studied numerically. Birefringence is explicitly shown in the power spectrum, though the difference in the amplitudes is small. Specific features of peaks and dips appear gravitational wave power spectrum mirroring chiral gravitational wave mediated parametric resonance during reheating. Our result represents a useful tool to test Chern-Simons gravity and enables to constrain mechanisms of inflation and reheating related to this theory. We predict a falsifiable pattern of observable peaks and dips in the chiral independent gravitational power spectrum, eventually observable in next space-borne gravitational interferometers, including LISA, Taiji and Tianqin.

Figures

Figures reproduced from arXiv: 2501.08240 by the authors.

**Figure 1.** Plot of the power spectrum of GWs damped by (dark) fermions, with right or left helicities, for a species of dark fermions with [PITH_FULL_IMAGE:figures/full_fig_p006_1.png] view at source ↗

**Figure 2.** We plot the result of the power spectrum of right/left-handed causal GWs, in a similar way to Fig. (1) - the damped left- and right [PITH_FULL_IMAGE:figures/full_fig_p007_2.png] view at source ↗

**Figure 3.** GWs’ evolution and zeroth component of the Boltzmann hi [PITH_FULL_IMAGE:figures/full_fig_p007_3.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

67 extracted references · 23 canonical work pages

[1]

B. P. Abbott, et al., Observation of Gravitational Waves from a Binary Black Hole Merger, Phys. Rev. Lett. 116 (6) (2016) 061102. arXiv:1602.03837, doi:10.1103/PhysRevLett.116. 061102

arXiv 2016
[2]

S. W. Ballmer, et al., Snowmass2021 Cosmic Frontier White Pa- per: Future Gravitational-Wave Detector Facilities, in: Snow- mass 2021, 2022. arXiv:2203.08228

arXiv 2021
[3]

Kalogera, et al., The Next Generation Global Gravitational Wave Observatory: The Science Book (11 2021).arXiv:2111

V. Kalogera, et al., The Next Generation Global Gravitational Wave Observatory: The Science Book (11 2021).arXiv:2111. 06990

work page 2021
[4]

Afzal, et al., The NANOGrav 15 yr Data Set: Search for Signals from New Physics, Astrophys

A. Afzal, et al., The NANOGrav 15 yr Data Set: Search for Signals from New Physics, Astrophys. J. Lett. 951 (1) (2023) L11. arXiv:2306.16219, doi:10.3847/2041-8213/acdc91

arXiv 2023
[5]

Christensen, Stochastic Gravitational Wave Backgrounds, Rept

N. Christensen, Stochastic Gravitational Wave Backgrounds, Rept. Prog. Phys. 82 (1) (2019) 016903. arXiv:1811.08797, doi:10.1088/1361-6633/aae6b5

arXiv 2019
[6]

J. B. Dent, L. M. Krauss, S. Sabharwal, T. Vachaspati, Damping of Primordial Gravitational Waves from Generalized Sources, Phys. Rev. D 88 (2013) 084008. arXiv:1307.7571, doi:10.1103/PhysRevD.88.084008

arXiv 2013
[7]

Ringwald, K

A. Ringwald, K. Saikawa, C. Tamarit, Primordial gravitational waves in a minimal model of particle physics and cosmol- ogy, JCAP 02 (2021) 046. arXiv:2009.02050, doi:10.1088/ 1475-7516/2021/02/046

arXiv 2021
[8]

G. Baym, S. P. Patil, C. J. Pethick, Damping of gravitational waves by matter, Phys. Rev. D 96 (8) (2017) 084033.arXiv: 1707.05192, doi:10.1103/PhysRevD.96.084033

arXiv 2017

Show all 67 references

[9]

Flauger, S

R. Flauger, S. Weinberg, Gravitational Waves in Cold Dark Matter, Phys.Rev.D97(12)(2018)123506. arXiv:1801.00386, doi:10.1103/PhysRevD.97.123506

2018 arXiv
[10]

Mirón-Granese, Relativistic viscous effects on the primordial gravitational waves spectrum, JCAP 06 (2021) 008

N. Mirón-Granese, Relativistic viscous effects on the primordial gravitational waves spectrum, JCAP 06 (2021) 008. arXiv: 2012.11422, doi:10.1088/1475-7516/2021/06/008

2021 arXiv
[11]

Zarei, N

M. Zarei, N. Bartolo, D. Bertacca, A. Ricciardone, S. Matar- rese, Non-Markovian open quantum system approach to the early Universe: Damping of gravitational waves by matter, Phys. Rev. D 104 (8) (2021) 083508.arXiv:2104.04836, doi: 10.1103/PhysRevD.104.083508

2021 arXiv
[12]

Bielefeld, R

J. Bielefeld, R. R. Caldwell, Cosmological consequences of classical flavor-space locked gauge field radiation, Phys. Rev. D 91 (12) (2015) 124004. arXiv:1503.05222, doi:10.1103/ PhysRevD.91.124004

2015 arXiv
[13]

A. D. Miravet, A. L. Maroto, Imprint of ultralight vector fields on gravitational wave propagation, Phys. Rev. D 103 (12) (2021) 123546. arXiv:2012.07505, doi:10.1103/PhysRevD. 103.123546

2021 arXiv
[14]

A. J. Tishue, R. R. Caldwell, Relic cosmological vector fields and inflationary gravitational waves, Phys. Rev. D 104 (6) (2021) 063531. arXiv:2105.08073, doi:10.1103/PhysRevD. 104.063531

2021 arXiv
[15]

A. D. Miravet, A. L. Maroto, Vector dark radiation and gravitational-wave polarization, JCAP 09 (2022) 014. arXiv: 2203.07125, doi:10.1088/1475-7516/2022/09/014

2022 arXiv
[16]

D 69 (2004) 023503

S.Weinberg, Dampingoftensormodesincosmology, Phys.Rev. D 69 (2004) 023503. arXiv:astro-ph/0306304, doi:10.1103/ PhysRevD.69.023503

2004 arXiv
[17]

A. Hook, G. Marques-Tavares, D. Racco, Causal gravitational waves as a probe of free streaming particles and the expansion of the Universe, JHEP 02 (2021) 117.arXiv:2010.03568, doi: 10.1007/JHEP02(2021)117

2021 arXiv
[18]

Brzeminski, A

D. Brzeminski, A. Hook, G. Marques-Tavares, Precision early universe cosmology from stochastic gravitational waves, JHEP 11 (2022) 061. arXiv:2203.13842, doi:10.1007/JHEP11(2022) 061

2022 arXiv
[19]

Jackiw, S.-Y

R. Jackiw, S.-Y. Pi, Chern-simons modification of general rela- tivity, Physical Review D 68 (10) (2003) 104012

2003
[20]

Alexander, N

S. Alexander, N. Yunes, Chern–simons modified general rel- ativity, Physics Reports 480 (1) (2009) 1–55. doi:https: //doi.org/10.1016/j.physrep.2009.07.002. URL https://www.sciencedirect.com/science/article/pii/ S037015730900177X

2009 doi
[21]

Lue, L.-M

A. Lue, L.-M. Wang, M. Kamionkowski, Cosmological sig- nature of new parity violating interactions, Phys. Rev. Lett. 83 (1999) 1506–1509. arXiv:astro-ph/9812088, doi:10.1103/ PhysRevLett.83.1506

1999 arXiv
[22]

S. H.-S. Alexander, M. E. Peskin, M. M. Sheikh-Jabbari, Lep- togenesis from gravity waves in models of inflation, Phys. Rev. Lett. 96 (2006) 081301. arXiv:hep-th/0403069, doi:10.1103/ PhysRevLett.96.081301

2006 arXiv
[23]

Alexander, S

S. Alexander, S. Cormack, A. Marcianò, N. Yunes, Gravitational-Wave Mediated Preheating, Phys. Lett. B 743 (2015) 82–86. arXiv:1405.4288, doi:10.1016/j.physletb. 2015.02.018

2015 arXiv
[24]

Alexander, C

S. Alexander, C. Creque-Sarbinowski, UV completions of Chern-Simons gravity, Phys. Rev. D 108 (10) (2023) 104046. arXiv:2207.05094, doi:10.1103/PhysRevD.108.104046

2023 arXiv
[25]

F. W. Hehl, How does one measure torsion of space-time?, Physics Letters A 36 (3) (1971) 225–226. doi:10.1016/ 0375-9601(71)90433-6

1971
[26]

F. W. Hehl, Spin and torsion in general relativity: I. founda- tions, General relativity and gravitation 4 (1973) 333–349

1973
[27]

F. W. Hehl, Spin and torsion in general relativity ii: geometry and field equations, General relativity and gravitation 5 (1974) 491–516

1974
[28]

F. W. Hehl, P. Von Der Heyde, G. D. Kerlick, J. M. Nester, General Relativity with Spin and Torsion: Foundations and Prospects, Rev. Mod. Phys. 48 (1976) 393–416.doi:10.1103/ RevModPhys.48.393

1976
[29]

URL https://books.google.com.sg/books?id=-MHvAAAAMAAJ

E.Lord, Tensors, RelativityandCosmology, TataMcGraw-Hill, 1976. URL https://books.google.com.sg/books?id=-MHvAAAAMAAJ

1976
[30]

Gasperini, V

M. Gasperini, V. de Sabbata, Introduction to Grav- itation, WORLD SCIENTIFIC, 1986. arXiv:https: //www.worldscientific.com/doi/pdf/10.1142/0233, doi:10.1142/0233. URL https://www.worldscientific.com/doi/abs/10.1142/ 0233

1986 doi
[31]

De Sabbata, C

V. De Sabbata, C. Sivaram, Spin and Torsion in Gravitation, G - Reference,Information and Interdisciplinary Subjects Series, World Scientific, 1994. URL https://books.google.com.sg/books?id=Y6LvPkD9UyoC

1994
[32]

I. L. Shapiro, Physical aspects of the space-time torsion, Phys. Rept. 357 (2002) 113. arXiv:hep-th/0103093, doi:10.1016/ S0370-1573(01)00030-8

2002 arXiv
[33]

R. T. Hammond, Torsion gravity, Reports on Progress in Physics 65 (5) (2002) 599

2002
[34]

Alexander, C

S. Alexander, C. Bambi, A. Marciano, L. Modesto, Fermi- bounce Cosmology and scale invariant power-spectrum, Phys. Rev. D 90 (12) (2014) 123510.arXiv:1402.5880, doi:10.1103/ PhysRevD.90.123510

2014 arXiv
[35]

Bambi, D

C. Bambi, D. Malafarina, A. Marcianò, L. Modesto, Singu- larity avoidance in classical gravity from four-fermion inter- action, Phys. Lett. B 734 (2014) 27–30. arXiv:1402.5719, doi:10.1016/j.physletb.2014.05.013

2014 arXiv
[36]

Alexander, Y.-F

S. Alexander, Y.-F. Cai, A. Marciano, Fermi-bounce cosmology and the fermion curvaton mechanism, Phys. Lett. B 745 (2015) 97–104. arXiv:1406.1456, doi:10.1016/j.physletb.2015.04. 026

2015 arXiv
[37]

Addazi, S

A. Addazi, S. Alexander, Y.-F. Cai, A. Marciano, Dark mat- ter and baryogenesis in the Fermi-bounce curvaton mecha- nism, Chin. Phys. C 42 (6) (2018) 065101.arXiv:1612.00632, doi:10.1088/1674-1137/42/6/065101

2018 arXiv
[38]

Addazi, P

A. Addazi, P. Chen, A. Marciano, Emergent inflation from a Nambu–Jona-Lasinio mechanism in gravity with non-dynamical torsion, Eur. Phys. J. C 79 (4) (2019) 297.arXiv:1712.04848, doi:10.1140/epjc/s10052-019-6803-7

2019 arXiv
[39]

Addazi, A

A. Addazi, A. Marciano, Quantum Ekpyrotic mechanism in Fermi-bounce curvaton cosmology (10 2018). arXiv:1810. 05513

2018
[40]

Choi, J.-c

K. Choi, J.-c. Hwang, K. W. Hwang, String theoretic axion 9 coupling and the evolution of cosmic structures, Phys. Rev. D 61 (2000) 084026. arXiv:hep-ph/9907244, doi:10.1103/ PhysRevD.61.084026

2000 arXiv
[41]

Alexander, J

S. Alexander, J. Martin, Birefringent gravitational waves and the consistency check of inflation, Phys. Rev. D 71 (2005) 063526. arXiv:hep-th/0410230, doi:10.1103/PhysRevD.71. 063526

2005 arXiv
[42]

Loverde, Z

M. Loverde, Z. J. Weiner, Probing neutrino interactions and dark radiation with gravitational waves, JCAP 02 (2023) 064. arXiv:2208.11714, doi:10.1088/1475-7516/2023/02/064

2023 arXiv
[43]

C.-P. Ma, E. Bertschinger, Cosmological perturbation theory in the synchronous and conformal Newtonian gauges, Astrophys. J. 455 (1995) 7–25. arXiv:astro-ph/9506072, doi:10.1086/ 176550

1995 arXiv
[44]

I. M. Oldengott, T. Tram, C. Rampf, Y. Y. Y. Wong, In- teracting neutrinos in cosmology: exact description and con- straints, JCAP11(2017)027. arXiv:1706.02123, doi:10.1088/ 1475-7516/2017/11/027

2017 arXiv
[45]

Virtanen, et al., SciPy 1.0–Fundamental Algorithms for Sci- entific Computing in Python, Nature Meth

P. Virtanen, et al., SciPy 1.0–Fundamental Algorithms for Sci- entific Computing in Python, Nature Meth. 17 (2020) 261. arXiv:1907.10121, doi:10.1038/s41592-019-0686-2

2020 arXiv
[46]

Wanner, E

G. Wanner, E. Hairer, Solving ordinary differential equations II, Vol. 375, Springer Berlin Heidelberg New York, 1996

1996
[47]

Freytsis, Z

M. Freytsis, Z. Ligeti, Dark matter models with uniquely spin-dependent detection possibilities, Phys. Rev. D 83 (2011) 115009. doi:10.1103/PhysRevD.83.115009. URL https://link.aps.org/doi/10.1103/PhysRevD.83. 115009

2011 doi
[48]

Banerjee, D

S. Banerjee, D. Barducci, G. Bélanger, B. Fuks, A. Goudelis, B. Zaldivar, Cornering pseudoscalar-mediated dark matter with the LHC and cosmology, JHEP 07 (2017) 080. arXiv:1705. 02327, doi:10.1007/JHEP07(2017)080

2017 doi
[49]

Banerjee, G

S. Banerjee, G. Bélanger, D. Bhatia, B. Fuks, S. Raychaudhuri, Phenomenological analysis of multi-pseudoscalar mediated dark matter models, JHEP 07 (2022) 111.arXiv:2110.15391, doi: 10.1007/JHEP07(2022)111

2022 arXiv
[50]

Ghosh, P

P. Ghosh, P. Konar, A. K. Saha, S. Show, Self-interacting freeze-in dark matter in a singlet doublet scenario, Journal of Cosmology and Astroparticle Physics 2022 (10) (2022) 017. doi:10.1088/1475-7516/2022/10/017. URL https://dx.doi.org/10.1088/1475-7516/2022/10/017

2022 doi
[51]

Girmohanta, R

S. Girmohanta, R. Shrock, Cross section calculations in theo- ries of self-interacting dark matter, Phys. Rev. D 106 (2022) 063013. doi:10.1103/PhysRevD.106.063013. URL https://link.aps.org/doi/10.1103/PhysRevD.106. 063013

2022 doi
[52]

Inomata, W

A. Inomata, W. A. McKinley, Geometric theory of neutrinos, Phys. Rev. 140 (1965) B1467–B1473. doi:10.1103/PhysRev. 140.B1467. URL https://link.aps.org/doi/10.1103/PhysRev.140.B1467

1965 doi
[53]

C. J. Moore, D. P. Mihaylov, A. Lasenby, G. Gilmore, As- trometric Search Method for Individually Resolvable Gravi- tational Wave Sources with Gaia, Phys. Rev. Lett. 119 (26) (2017) 261102. arXiv:1707.06239, doi:10.1103/PhysRevLett. 119.261102

2017 arXiv
[54]

S. A. Klioner, Gaia-like astrometry and gravitational waves, Class. Quant. Grav. 35 (4) (2018) 045005.arXiv:1710.11474, doi:10.1088/1361-6382/aa9f57

2018 arXiv
[55]

Garcia-Bellido, H

J. Garcia-Bellido, H. Murayama, G. White, Exploring the early UniversewithGaiaandTheia, JCAP12(12)(2021)023. arXiv: 2104.04778, doi:10.1088/1475-7516/2021/12/023

2021 arXiv
[56]

Çalışkan, Y

M. Çalışkan, Y. Chen, L. Dai, N. Anil Kumar, I. Stomberg, X. Xue, Dissecting Stochastic Gravitational Wave Background with Astrometry (12 2023).arXiv:2312.03069

2023 arXiv
[57]

Collaboration, et al., The gaia mission, arXiv preprint arXiv:1609.04153 (2016)

G. Collaboration, et al., The gaia mission, arXiv preprint arXiv:1609.04153 (2016)

2016 arXiv
[58]

Y. Wang, K. Pardo, T.-C. Chang, O. Doré, Gravitational Wave Detection with Photometric Surveys, Phys. Rev. D 103 (8) (2021) 084007. arXiv:2010.02218, doi:10.1103/PhysRevD. 103.084007

2021 arXiv
[59]

Y. Wang, K. Pardo, T.-C. Chang, O. Doré, Constraining the stochastic gravitational wave background with photometric sur- veys, Phys. Rev. D 106 (8) (2022) 084006.arXiv:2205.07962, doi:10.1103/PhysRevD.106.084006

2022 arXiv
[60]

Haiman, et al., Massive Black Hole Binaries as LISA Pre- cursors in the Roman High Latitude Time Domain Survey (6 2023)

Z. Haiman, et al., Massive Black Hole Binaries as LISA Pre- cursors in the Roman High Latitude Time Domain Survey (6 2023). arXiv:2306.14990

2023 arXiv
[61]

Pardo, T.-C

K. Pardo, T.-C. Chang, O. Doré, Y. Wang, Gravitational Wave Detection with Relative Astrometry using Roman’s Galactic Bulge Time Domain Survey (6 2023).arXiv:2306.14968

2023 arXiv
[62]

Boehm, A

C. Boehm, A. Krone-Martins, A. Amorim, G. Anglada-Escude, A. Brandeker, F. Courbin, T. Ensslin, A. Falcao, K. Freese, B. Holl, et al., Theia: Faint objects in motion or the new as- trometry frontier, arXiv preprint arXiv:1707.01348 (2017)

2017 arXiv
[63]

Malbet, C

F. Malbet, C. Boehm, A. Krone-Martins, A. Amorim, G. Anglada-Escudé, A. Brandeker, F. Courbin, T. Ensslin, A. Falcão, K. Freese, et al., Faint objects in motion: the new frontier of high precision astrometry, Experimental Astronomy 51 (2021) 845–886

2021
[64]

L. G. Book, E. E. Flanagan, Astrometric Effects of a Stochas- tic Gravitational Wave Background, Phys. Rev. D 83 (2011) 024024. arXiv:1009.4192, doi:10.1103/PhysRevD.83.024024

2011 arXiv
[65]

C. R. Harris, et al., Array programming with NumPy, Nature 585 (7825) (2020) 357–362. arXiv:2006.10256, doi:10.1038/ s41586-020-2649-2

2020 arXiv
[66]

J. D. Hunter, Matplotlib: A 2D Graphics Environment, Com- put. Sci. Eng. 9 (3) (2007) 90–95.doi:10.1109/MCSE.2007.55

2007 doi
[67]

URL https://joblib.readthedocs.io/ 10

Joblib Development Team, Joblib: running python functions as pipeline jobs, version: 1.4.2 (2024). URL https://joblib.readthedocs.io/ 10

2024

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.

[1] [1]

B. P. Abbott, et al., Observation of Gravitational Waves from a Binary Black Hole Merger, Phys. Rev. Lett. 116 (6) (2016) 061102. arXiv:1602.03837, doi:10.1103/PhysRevLett.116. 061102

arXiv 2016

[2] [2]

S. W. Ballmer, et al., Snowmass2021 Cosmic Frontier White Pa- per: Future Gravitational-Wave Detector Facilities, in: Snow- mass 2021, 2022. arXiv:2203.08228

arXiv 2021

[3] [3]

Kalogera, et al., The Next Generation Global Gravitational Wave Observatory: The Science Book (11 2021).arXiv:2111

V. Kalogera, et al., The Next Generation Global Gravitational Wave Observatory: The Science Book (11 2021).arXiv:2111. 06990

work page 2021

[4] [4]

Afzal, et al., The NANOGrav 15 yr Data Set: Search for Signals from New Physics, Astrophys

A. Afzal, et al., The NANOGrav 15 yr Data Set: Search for Signals from New Physics, Astrophys. J. Lett. 951 (1) (2023) L11. arXiv:2306.16219, doi:10.3847/2041-8213/acdc91

arXiv 2023

[5] [5]

Christensen, Stochastic Gravitational Wave Backgrounds, Rept

N. Christensen, Stochastic Gravitational Wave Backgrounds, Rept. Prog. Phys. 82 (1) (2019) 016903. arXiv:1811.08797, doi:10.1088/1361-6633/aae6b5

arXiv 2019

[6] [6]

J. B. Dent, L. M. Krauss, S. Sabharwal, T. Vachaspati, Damping of Primordial Gravitational Waves from Generalized Sources, Phys. Rev. D 88 (2013) 084008. arXiv:1307.7571, doi:10.1103/PhysRevD.88.084008

arXiv 2013

[7] [7]

Ringwald, K

A. Ringwald, K. Saikawa, C. Tamarit, Primordial gravitational waves in a minimal model of particle physics and cosmol- ogy, JCAP 02 (2021) 046. arXiv:2009.02050, doi:10.1088/ 1475-7516/2021/02/046

arXiv 2021

[8] [8]

G. Baym, S. P. Patil, C. J. Pethick, Damping of gravitational waves by matter, Phys. Rev. D 96 (8) (2017) 084033.arXiv: 1707.05192, doi:10.1103/PhysRevD.96.084033

arXiv 2017