Pith. sign in

REVIEW 3 major objections 7 minor 58 references

Emergent reactance induced by the deformation of a current-driven skyrmion lattice

T0 review · 3 major / 7 minor · reviewed 2026-08-07 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read The paper reports that a current-driven skyrmion lattice in MnSi shows longitudinal and Hall reactance during creep motion, and attributes the two signals to inertial translation and internal deformation respectively.

desk verdict Solid transport data on a new creep-regime reactance in a skyrmion lattice, but the longitudinal mechanism is not established—the paper's own spin-tilting calculation gives the wrong sign. read the letter →

arxiv 2505.18029 v1 pith:ADUQDGWK submitted 2025-05-23 cond-mat.mtrl-sci cond-mat.mes-hall

Matthew T. Littlehales , Max T. Birch , Akiko Kikkawa , Yasujiro Taguchi , Diego Alba Venero , Peter D. Hatton , Naoto Nagaosa , Yoshinori Tokura
show 1 more author
Tomoyuki Yokouchi
This is my paper · ORCID
classification cond-mat.mtrl-scicond-mat.mes-hall
keywords emergentreactanceskyrmionlatticeMnSiBerryphaseelectricfieldeffectivemassphasonmodescreepmotion
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper reports the first experimental evidence of emergent reactance in a skyrmion lattice, using MnSi as the material. It measures the imaginary (out-of-phase) parts of both the longitudinal and Hall resistivities while an AC current drives the skyrmion lattice through creep motion, in which skyrmions hop between pinning sites and deform as they move. Both signals appear only in the skyrmion-lattice phase and only above the creep threshold, and they peak in the creep region and fall in the flow region. The authors attribute the Hall reactance to the phase-shifted emergent electric field from inertial translational motion (an effective skyrmion mass), and the longitudinal reactance to emergent fields from phason and spin-tilting deformation modes. If correct, deformation of skyrmions becomes a controllable source of phase-modifying emergent electromagnetism that operates at low critical current densities.

What carries the argument

The machinery is the emergent electromagnetic field formalism, in which the Berry phase acquired by conduction electrons traversing a non-collinear spin texture acts as fictitious fields: the emergent magnetic field bem deflects electrons (topological Hall effect), while motion of the texture produces an emergent electric field eem = (ħ/2πe) n · (∂i n × ∂t n). For translational motion this reduces to eem = -vSk × bem; the velocity obeys a Thiele equation with a deformation-renormalized skyrmion mass msk, anharmonic pinning potential, gyro-coupling, and damping, which shifts the phase of vSk relative to the AC current. For deformation, the skyrmion lattice is decomposed into three helices with phason φi and spin-tilting βi modes, and the spatial average of the emergent electric field from a longitudinal spin-tilting mode is ⟨ex⟩ = (3ħQ/4e) ∂t βa, with zero transverse average. The reactance signals Im[ρyx] and Im[ρxx] are the out-of-phase parts of these emergent fields relative to the applied AC current.

What would settle it

A decisive check would be to measure Im[ρyx] and Im[ρxx] through the full B-T plane with the same phase-correction procedure but with the sample in a field-polarized or conical state, and to repeat the correction at several temperatures and frequencies; if the corrected imaginary resistivity in non-skyrmion phases is not identically zero, or if the inferred skyrmion-phase reactance changes when the correction is recomputed with field-dependent phase rotation, the central claim fails. A second check is whether the sign change of Im[ρyx] near 500 Hz shifts with the creep and flow boundaries as expected from the Thiele mass term.

Watch

Extended reading notes

Core claim

The central discovery claim is that a moving and deforming skyrmion lattice produces measurable out-of-phase emergent electric fields, i.e., reactance, whose two components have distinct physical origins. The transverse reactance Im[ρyx] is attributed to the inertial term msk ˙vSk in the Thiele equation: since the skyrmion mass arises from deformation that stores energy, the creep-region velocity acquires a phase shift relative to the AC current, so the emergent field eem = -vSk × bem develops an imaginary Hall component that can change sign with frequency and field. The longitudinal reactance Im[ρxx] is attributed instead to the excitation of phason and spin-tilting modes of the three-helix decomposition of the skyrmion lattice, whose time derivatives generate an emergent electric field along the current direction. The paper argues that the sign behavior distinguishes these mechanisms: only Im[ρyx] changes sign in the B-T and JAC-frequency planes, ruling out a common origin through the skyrmion Hall angle.

Load-bearing premise

The identification of the measured imaginary resistivities as intrinsic skyrmion-lattice reactance assumes that the field-polarized state has exactly zero imaginary response and that a single global phase-rotation correction plus subtraction fully removes cable and instrument artifacts; if the extrinsic phase rotation or reactance varies with magnetic field or temperature, the apparent skyrmion-phase signal could be spurious.

Editorial extensions

If this is right

  • The measured reactance provides a direct electrical readout of skyrmion deformation during creep, since both signals vanish in the pinned state and are reduced in the flow state.
  • The sign change of Im[ρyx] around 500 Hz distinguishes inertial translational dynamics from deformation-induced longitudinal effects, offering a frequency-domain test of skyrmion effective mass.
  • Because the skyrmion-lattice creep threshold is lower than those of helices and domain walls, skyrmion lattices may generate emergent reactance at lower current densities than other spin textures.
  • The longitudinal reactance from phason and spin-tilting modes appears only when the Q-vectors are not perpendicular to the current, explaining why the conical phase (Q parallel to B) shows no signal.
  • The reactance is absent in the helical phase under the currents used, consistent with its higher critical current density for motion.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial inference: the same two-channel decomposition could be tested in other skyrmion hosts by checking whether Im[ρyx] changes sign at a frequency set by the ratio of the effective mass to the damping, as predicted by the Thiele equation.
  • Editorial inference: a device exploiting creep-region reactance would need to operate near the creep threshold; since thresholds rise with frequency, the useful frequency window may be limited by the freezing of skyrmion motion.
  • Editorial inference: if the sign of longitudinal reactance is dominated by phason modes, thermal tuning across the skyrmion phase could provide a way to switch emergent inductance between positive and negative values.
  • Editorial inference: the results imply that deformation, previously treated mainly as a dissipative correction, is itself a source of reactive power in topological spin-texture circuits.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 7 minor

Summary. The manuscript reports AC transport measurements on a microfabricated MnSi thin plate and observes imaginary components of the longitudinal and Hall resistivities that appear only in the skyrmion-lattice phase and peak in the creep-motion regime. The authors use the current-density and frequency dependence of the topological Hall resistivity to identify pinned, creep, and flow regimes, and they attribute the Hall reactance to a phase-shifted translational skyrmion velocity arising from an effective mass, and the longitudinal reactance to emergent electric fields from phason and spin-tilting modes. The Supplementary Information includes phase-rotation corrections, DC-bias checks, Joule-heating estimates, and a phenomenological calculation for one spin-tilting mode.

Significance. The experimental observation of a reactance confined to the moving/deforming skyrmion lattice would be a notable extension of emergent electromagnetism and could be technologically interesting because of the low threshold currents. The data set is carefully built: the reactance is phase-constrained, tied to the creep regime through independent THE measurements, reproduced under DC bias, and checked against Joule heating. However, the paper's central mechanistic attribution is not yet quantitatively established; in particular, the sign of the longitudinal reactance is not reproduced by the provided calculation, and the phason contribution that would fix the sign is explicitly deferred.

major comments (3)
  1. [Main text, paragraph after Eq. (5); SI §V, Eqs. (7)-(8)] The attribution of the longitudinal reactance to phason and spin-tilting modes is not supported by the calculation presented. SI §V derives ⟨ex⟩ = (3ℏQ/4e) ∂tβx for a spin-tilting mode, which for a harmonic drive gives a positive inductive-like Im[ρxx], whereas the observed longitudinal reactance in the creep region is negative (Figs. 3e and 4c). The paper then states that the phason mode is expected to be important because of the negative sign, and that further theoretical investigation remains future work. This leaves the sign and magnitude of the central longitudinal signal unexplained. The abstract's claim that the longitudinal reactance 'results from' these modes is therefore an overstatement; it should be presented as a conjecture unless a calculation reproducing the negative sign is provided.
  2. [SI §V, after Eq. (1); main text around Imρyx = P_bem v''_sk/jAC] The Hall-reactance explanation is qualitative. The relation Imρyx = P_bem v''_sk/jAC defines the out-of-phase velocity rather than predicting it, and the sign change is attributed to 'the damping parameters, the shape of the potential, and the frequency' without a concrete model. A solution of the Thiele equation with an anharmonic pinning potential showing that v''_sk can have either sign and tracking the observed frequency and field dependence is needed to substantiate the claim that inertial translational motion is the mechanism. Without it, the statement that Im[ρyx] arises from the skyrmion effective mass is not falsifiable at the quantitative level claimed.
  3. [SI §I] The entire intrinsic-signal conclusion rests on the assumption that the field-polarized phase has zero imaginary resistivity and that a single global phase rotation per field sweep removes all extrinsic reactance. The manuscript should quantify the uncertainty in the fitted rotation angle across the SkL field/temperature window and demonstrate that the extracted Im[ρxx] and Im[ρyx] are insensitive to the choice of the field-polarized fitting region. If the parasitic phase or extrinsic reactance varies with field or temperature, the apparent phase confinement of the reactance to the SkL could be generated by the correction procedure rather than by the sample.
minor comments (7)
  1. [Abstract] The phrase 'as a important factor' should be 'as an important factor'.
  2. [Methods, Eq. (7)] The fitting function uses the symbol a both as a prefactor and inside the error-function integrand; this is likely a typo and should be clarified.
  3. [SI §I] The sentence 'Whereas, for Im[ρyx], we simply subtract this component' should read 'for Im[ρxx]', since the preceding sentence states that the symmetric extrinsic reactance is automatically removed for Im[ρyx].
  4. [SI §V] The sentence 'insert Eq. (3) into Eqs. (6) and (7)' should refer to Eqs. (5) and (6), since those are the equations defining ex and ey.
  5. [Fig. S1 caption] The value JAC = 9.21 A m^-2 appears to be missing an exponent; all other current densities in the paper are of order 10^7-10^8 A m^-2.
  6. [Figs. 3d-e and 4b-c] No error bars or noise-floor estimates are shown; please add them or state the noise level quantitatively so that the magnitude of the reactance signals can be assessed.
  7. [Main text, paragraph after Eq. (5)] The argument that the skyrmion-Hall mechanism would give Im[ρxx] and Im[ρyx] the same sign assumes a real, frequency-independent skyrmion Hall angle; this assumption should be stated explicitly or justified.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: thresholds are fixed by independent THE reduction, reactance is not used to fit model parameters, and the longitudinal attribution's incompleteness is an under-support gap, not a self-referential derivation.

full rationale

The paper's derivation chain does not reduce to its own inputs by construction. The creep and flow thresholds used to interpret the reactance are determined from the independently measured current-density dependence of the topological Hall resistivity, not from the reactance data itself. The transverse reactance formula Imρyx = P bem v''/jAC is a phenomenological rewriting of eem = -v × bem; the out-of-phase velocity v'' is not fitted to the reactance or then presented as a prediction, and the paper explicitly leaves its sign and magnitude dependent on unspecified damping, potential, and frequency parameters. The longitudinal mechanism is admittedly incomplete: SI §V derives only the spin-tilting contribution, which has positive sign, while the data show negative Im[ρxx], and the paper states that "the phason mode of the SkL is expected to play an important role in the present case. However, further theoretical investigation remains a subject for future research." This is a support gap or correctness risk, not circularity, because the claim is not obtained by defining the phason contribution in terms of the measured reactance. The self-citations to prior emergent-inductor theories (Nagaosa 2019; Kurebayashi and Nagaosa 2021) are independent published parameter-free calculations with stated assumptions, so they do not constitute unverified load-bearing self-citation. The phase-rotation correction assumes the field-polarized state has zero imaginary response; again this is a calibrating assumption, not a fitted parameter hidden inside the claimed prediction. Overall, the experimental observation is self-contained and the mechanistic attributions are post hoc but not circular.

Assumptions & free parameters 2 free parameters · 4 assumptions · 0 invented entities

The central experimental observation depends on standard transport analysis assumptions and on the theoretical interpretation via the Thiele equation and deformation-mode decomposition. The phenomenological threshold-fitting parameters are the main adjustable numbers.

free parameters (2)
  • Effective emergent magnetic field P_bem = -0.79 T
    Estimated from the topological Hall resistivity at the center of the skyrmion phase, used in Eq. (2) to convert the reduction of the topological Hall resistivity into skyrmion velocity and to define the dynamical phases.
  • Empirical thresholds fit parameters a, b, c = not stated
    In Eq. (7), the current-density dependence of Delta Re[rho_THE_yx] is fit to an error-function-like form; the fitted parameters are used to determine the creep and flow thresholds that define the regime in which the reactance is observed.
assumptions (4)
  • standard math Emergent electromagnetic field formula e_em,i = (h/2πe) n · (∂_i n × ∂_t n)
    Used throughout to relate spin dynamics to emergent electric fields (Eq. 1).
  • domain assumption Thiele equation for skyrmion translational motion, including mass, gyro-coupling, damping, and pinning potential
    Used to explain the phase shift of v_Sk in the creep regime and the Hall reactance.
  • ad hoc to paper Field-polarized phase has zero imaginary resistivity, so a single phase-rotation correction removes all extrinsic reactance
    Basis of the phase-correction procedure in Supplementary Section I; if this assumption fails, the reactance signals could be artifacts.
  • domain assumption Deformed SkL can be described as a superposition of three helices with phason and spin-tilting modes (Eqs. 3-5)
    Used to model longitudinal emergent reactance; only a simplified single-mode case is computed.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Emergent reactance induced by the deformation of a current-driven skyrmion lattice." pith.science (2026). https://pith.science/paper/ADUQDGWK

@misc{pith2026250518029,
  author       = {Pith},
  title        = {Pith review of: Emergent reactance induced by the deformation of a current-driven skyrmion lattice},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/ADUQDGWK}},
  note         = {Machine review of arXiv:2505.18029}
}
read the original abstract

The interaction between conduction electrons and spin textures gives rise to remarkable phenomena associated with the Berry phase. The Berry phase acquired by conduction electrons acts as an emergent electromagnetic field, facilitating phenomena analogous to classical electromagnetism, such as the Lorentz force and electromagnetic induction. Magnetic skyrmions, spin vortices with non-trivial topology, serve as a key platform for such studies. For example, non-trivial transport responses are recognized as being induced by the emergent Lorentz force and the emergent electromagnetic induction. Despite remarkable progress in skyrmion physics, emergent reactance, in which the phase of an applied AC current is modified by emergent electromagnetism, has not been thoroughly investigated. Here, we report emergent reactance in the prototypical skyrmion-hosting material, MnSi. We observe longitudinal and Hall reactance signals as the skyrmion lattice undergoes creep motion, in which the skyrmions deform while moving. The Hall reactance is attributed to the emergent electric field associated with the inertial translational motion arising from the skyrmion effective mass. In contrast, the longitudinal reactance results from the emergent electric fields generated by the phason and spin-tilting modes excited by their deformation. Our findings shed light on the internal deformation degrees of freedom in skyrmions as a important factor for efficient generation of the emergent electric field.

Figures

Figures reproduced from arXiv: 2505.18029 by the authors.

Figure 1
Figure 1. FIG. 1 [PITH_FULL_IMAGE:figures/full_fig_p004_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2 [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p008_3.png] view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: FIG. 4 [PITH_FULL_IMAGE:figures/full_fig_p009_4.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

58 extracted references · 58 canonical work pages

  1. [1]

    A FEI Helios 5UX focused ion beam instrument was u sed to fabricate the thin- plate devices from the single crystal

    Sample preparation and device fabrication Single crystals of MnSi were grown by the Czochralski method and oriented using a Laue x-ray camera. A FEI Helios 5UX focused ion beam instrument was u sed to fabricate the thin- plate devices from the single crystal. First, a large slab of m aterial was created by means of Ga ion milling. Then, the slab was lifte...

    work page

  2. [2]

    The MnSi devices were mount ed on a standard PPMS puck using GE varnish

    Transport measurements All transport measurements were performed within a Quantum D esign Physical Proper- ties Measurement System (PPMS). The MnSi devices were mount ed on a standard PPMS puck using GE varnish. Cu wires were used to contact the subst rate with a combination of solder and colloidal silver paste. Measurements of the lo ngitudinal and Hall ...

    work page

  3. [3]

    The higher current density facilitates the extraction of the phase bou ndaries while being qualitatively similar to those observed at lower JAC (See supplementary information)

    Determination of magnetic phase boundaries The phase boundaries are calculated for measurements taken with a low current density of JAC = 4.26×108 A m−2 such as to capture the equilibrium skyrmion phase, avoiding potential expansions due to current induced skyrmion generation and Jo ule heating effects. The higher current density facilitates the extraction...

    work page

  4. [4]

    This equation provides a good phenom enological approximation of the profile of the current density dependen ce of ∆Re[ ρTHE yx ]

    Determination of creep and flow thresholds To determine the creep ( J C) and flow ( J F ) thresholds, we first fit ∆Re[ ρyx] according to the equation ∆Re [ ρTHE yx ] = a [ a √π ∫ J−b c 0 e−t2 dt + 1 ] , (7) where a,b, and c are fitting parameters. This equation provides a good phenom enological approximation of the profile of the current density dependen ce of...

    work page

  5. [5]

    Calculation of electron velocity The electron velocity in Fig. 2(c) was calculated from the ord inary Hall coefficient R0 according to the classical Drude model such that ve = RHJDC = JDC ne , (8) where n is the electron number density and e is the electron charge. RH was obtained by fitting a straight line to the resistivity where |B| > 0.7 T. An example is...

    work page 2024

  6. [6]

    M. V. Berry, Quantal phase factors accompanying adiabatic changes, Proce edings of the Royal Society of London. A. Mathematical and Physical Sciences 392, 45 (1984)

    work page 1984

  7. [7]

    Nagaosa, J

    N. Nagaosa, J. Sinova, S. Onoda, A. H. MacDonald, and N. P. Ong, Anomalous Hall effect, Reviews of Modern Physics 82, 1539 (2010)

    work page 2010

  8. [8]

    Zhang, Y.-W

    Y. Zhang, Y.-W. Tan, H. L. Stormer, and P. Kim, Experimental observation of the quantum Hall effect and Berry’s phase in graphene, Nature 438, 201 (2005)

    work page 2005

Show all 58 references
  1. [9]

    Qi and S.-C

    X.-L. Qi and S.-C. Zhang, Topological insulators and superconductors, Rev iews of Modern Physics 83, 1057 (2011)

    2011

  2. [10]

    N. P. Armitage, E. J. Mele, and A. Vishwanath, Weyl and Dirac semimetals i n three- dimensional solids, Reviews of Modern Physics 90, 015001 (2018)

    2018

  3. [11]

    M¨ uhlbauer, B

    S. M¨ uhlbauer, B. Binz, F. Jonietz, C. Pfleiderer, A. Rosch, A. Neu bauer, R. Georgii, and P. B¨ oni, Skyrmion lattice in a chiral magnet, Science 323, 915 (2009)

    2009

  4. [12]

    M. T. Birch, D. Cort´ es-Ortu˜ no, L. A. Turnbull, M. N. Wilson, F. G roß, N. Tr¨ ager, A. Lau- renson, N. Bukin, S. H. Moody, M. Weigand, G. Sch¨ utz, H. Popescu, R. F an, P. Steadman, J. A. T. Verezhak, G. Balakrishnan, J. C. Loudon, A. C. Twitchett-Harrison , O. Hovorka, H....

    2020

  5. [13]

    Kurumaji, T

    T. Kurumaji, T. Nakajima, M. Hirschberger, A. Kikkawa, Y. Yamasaki, H. S agayama, H. Nakao, Y. Taguchi, T.-h. Arima, and Y. Tokura, Skyrmion lattice with a giant topol ogical Hall effect in a frustrated triangular-lattice magnet, Science 365, 914 (2019)

    2019

  6. [14]

    Jonietz, S

    F. Jonietz, S. M¨ uhlbauer, C. Pfleiderer, A. Neubauer, W. M¨ unze r, A. Bauer, T. Adams, R. Georgii, P. B¨ oni, R. A. Duine, K. Everschor, M. Garst, and A. Rosch, S pin transfer torques in MnSi at ultralow current densities, Science 330, 1648 (2010)

    2010

  7. [15]

    L. Peng, K. Karube, Y. Taguchi, N. Nagaosa, Y. Tokura, and X. Yu, Dynamic transition of current-driven single-skyrmion motion in a room-temperature chi ral-lattice magnet, Nature Communications 12, 6797 (2021)

    2021

  8. [16]

    Luo, S.-Z

    Y. Luo, S.-Z. Lin, M. Leroux, N. Wakeham, D. M. Fobes, E. D. Bauer, J. B. Be tts, J. D. Thompson, A. Migliori, M. Janoschek, and B. Maiorov, Skyrmion lattice cre ep at ultra-low current densities, Communications Materials 1, 83 (2020). 16

    2020

  9. [18]

    B¨ uttner, C

    F. B¨ uttner, C. Moutafis, M. Schneider, B. Kr¨ uger, C. M. G¨ unt her, J. Geilhufe, C. v. K. Schmising, J. Mohanty, B. Pfau, S. Schaffert, A. Bisig, M. Foerster, T . Schulz, C. A. F. Vaz, J. H. Franken, H. J. M. Swagten, M. Kl¨ aui, and S. Eisebitt, Dynamic s and inertia of sky...

    2015

  10. [19]

    Reichhardt, D

    C. Reichhardt, D. Ray, and C. J. O. Reichhardt, Collective trans port properties of driven skyrmions with random disorder, Physical Review Letters 114, 217202 (2015)

    2015

  11. [20]

    Yokouchi, N

    T. Yokouchi, N. Kanazawa, A. Kikkawa, D. Morikawa, K. Shibata, T. Arima, Y. T aguchi, F. Kagawa, and Y. Tokura, Electrical magnetochiral effect induced by chir al spin fluctuations, Nature Communications 8, 866 (2017)

    2017

  12. [22]

    G. E. Volovik, Linear momentum in ferromagnets, Journal of Physics C: Solid State Physics 20, L83 (1987)

    1987

  13. [23]

    Nagaosa and Y

    N. Nagaosa and Y. Tokura, Topological properties and dynamics of magnetic skyrmion s, Nature Nanotechnology 8, 899 (2013)

    2013

  14. [24]

    J. Zang, M. Mostovoy, J. H. Han, and N. Nagaosa, Dynamics of skyrmion crystals in metallic thin films, Physical Review Letters 107, 136804 (2011)

    2011

  15. [26]

    Yokouchi, F

    T. Yokouchi, F. Kagawa, M. Hirschberger, Y. Otani, N. Nagaosa, and Y. Tokura, Emer gent electromagnetic induction in a helical-spin magnet, Nature 586, 232 (2020)

    2020

  16. [27]

    Kitaori, N

    A. Kitaori, N. Kanazawa, T. Yokouchi, F. Kagawa, N. Nagaosa, and Y. Tokura, Emergent electromagnetic induction beyond room temperature, Proceedings of t he National Academy of Sciences 118, e2105422118 (2021)

    2021

  17. [28]

    Zhang, Y

    Z. Zhang, Y. Matsushima, Y. Ohashi, M. Matsuzaka, and H. Kaiju, Emergent magn eto- inductance effect in Ni 45Fe55 thin films on polycarbonate substrates, 2023 IEEE International Magnetic Conference - Short Papers (INTERMAG Short Papers) , 1 (2023). 17

    2023

  18. [29]

    Kitaori, J

    A. Kitaori, J. S. White, V. Ukleev, L. Peng, K. Nakajima, N. Kanazawa, X. Yu, Y. ¯Onuki, and Y. Tokura, Enhanced emergent electromagnetic inductance in Tb 5Sb3 due to highly disordered helimagnetism, Communications Physics 7, 159 (2024)

    2024

  19. [31]

    Ieda and Y

    J. Ieda and Y. Yamane, Intrinsic and extrinsic tunability of rashba spin-orbit coupled emergent inductors, Physical Review B 103, L100402 (2021)

    2021

  20. [32]

    Yamane, S

    Y. Yamane, S. Fukami, and J. Ieda, Theory of emergent inductance with s pin-orbit coupling effects, Physical Review Letters 128, 147201 (2022)

    2022

  21. [33]

    Shimizu, S

    K. Shimizu, S. Okumura, Y. Kato, and Y. Motome, Emergent electric fiel d from magnetic resonances in a one-dimensional chiral magnet, Physical Review B 108, 134436 (2023)

    2023

  22. [34]

    Araki and J

    Y. Araki and J. Ieda, Emergence of inductance and capacitance from topological electromag- netism, Journal of the Physical Society of Japan 92, 074705 (2023)

    2023

  23. [35]

    Oh and N

    T. Oh and N. Nagaosa, Emergent inductance from spin fluctuations in strongly correlated magnets, Physical Review Letters 132, 116501 (2024)

    2024

  24. [36]

    Furuta, W

    S. Furuta, W. Koshibae, and F. Kagawa, Symmetry of the emergent induc tance tensor exhib- ited by magnetic textures, npj Spintronics 1, 3 (2023)

    2023

  25. [37]

    Scheuchenpflug, S

    L. Scheuchenpflug, S. Esser, R. Gruhl, M. Hirschberger, and P. Ge genwart, Current-linear emergent induction of pinned skyrmion textures in an oxide bilaye r (2025), arXiv:2503.10600 [cond-mat.mes-hall]

    2025 arXiv

  26. [38]

    Yamanouchi, D

    M. Yamanouchi, D. Chiba, F. Matsukura, and H. Ohno, Current-induced domain-wall switch- ing in a ferromagnetic semiconductor structure, Nature 428, 539 (2004)

    2004

  27. [39]

    Kimoto, H

    Y. Kimoto, H. Masuda, T. Seki, Y. Nii, J.-i. Ohe, Y. Nambu, and Y. Onose, Curr ent-induced sliding motion in a helimagnet MnAu 2, Physical Review Letters 134, 056702 (2025)

    2025

  28. [40]

    Neubauer, C

    A. Neubauer, C. Pfleiderer, B. Binz, A. Rosch, R. Ritz, P. G. Niklow itz, and P. B¨ oni, Topo- logical Hall effect in the A phase of MnSi, Physical Review Letters 102 (2009)

    2009

  29. [41]

    T. Sato, W. Koshibae, A. Kikkawa, Y. Taguchi, N. Nagaosa, Y. Tokura, and F. Kagawa, Non- thermal current-induced transition from skyrmion lattice to nontop ological magnetic phase in spatially confined MnSi, Physical Review B 106, 144425 (2022)

    2022

  30. [42]

    Iwasaki, M

    J. Iwasaki, M. Mochizuki, and N. Nagaosa, Universal current-velocity r elation of skyrmion motion in chiral magnets, Nature Communications 4, 1463 (2013). 18

    2013

  31. [44]

    A. A. Thiele, Steady-state motion of magnetic domains, Physical Review Letters 30, 230 (1973)

    1973

  32. [45]

    Sch¨ utte, J

    C. Sch¨ utte, J. Iwasaki, A. Rosch, and N. Nagaosa, Inertia, diffusion, and dy namics of a driven skyrmion, Physical Review B 90, 174434 (2014)

    2014

  33. [46]

    D. Song, W. Wang, S. Zhang, Y. Liu, N. Wang, F. Zheng, M. Tian, R. E. Dunin-Bor kowski, J. Zang, and H. Du, Steady motion of 80-nm-size skyrmions in a 100-nm-wide trac k, Nature Communications 15, 5614 (2024)

    2024

  34. [48]

    Hoshino and N

    S. Hoshino and N. Nagaosa, Theory of the magnetic skyrmion glass, Physical Revi ew B 97, 024413 (2018)

    2018

  35. [49]

    Ishikawa, K

    Y. Ishikawa, K. Tajima, D. Bloch, and M. Roth, Helical spin structu re in manganese silicide MnSi, Solid State Communications 19, 525 (1976)

    1976

  36. [50]

    P. W. Anderson and Y. B. Kim, Hard superconductivity: Theory of the mot ion of abrikosov flux lines, Reviews of Modern Physics 36, 39 (1964)

    1964

  37. [51]

    Bauer and C

    A. Bauer and C. Pfleiderer, Magnetic phase diagram of MnSi inferred from magnetization and AC susceptibility, Physical Review B 85, 214418 (2012). 19 Emergent reactance induced by the deformation of a current-driven skyrmion lattice: Supplementary Information Matthew T. Littleh...

    2012

  38. [52]

    Choi, G.-H

    J. Choi, G.-H. Lee, J. Yang, J. Kang, B.-G. Park, A. M. G. Park, and K.-J. K im, Question- ing the validity of spintronic inductors: Potential artifacts in eme rgent inductance, Applied Physics Letters 125, 192403 (2024)

    2024

  39. [53]

    Bauer and C

    A. Bauer and C. Pfleiderer, Magnetic phase diagram of MnSi inferred from magnetization and AC susceptibility, Physical Review B 85, 214418 (2012)

    2012

  40. [54]

    M. T. Birch, I. Belopolski, Y. Fujishiro, M. Kawamura, A. Kikkawa, Y. Taguchi, M. Hirschberger, N. Nagaosa, and Y. Tokura, Dynamic transition and galilean relativ ity of current-driven skyrmions, Nature 633, 554 (2024)

    2024

  41. [55]

    Schulz, R

    T. Schulz, R. Ritz, A. Bauer, M. Halder, M. Wagner, C. Franz, C. Pflei derer, K. Everschor, M. Garst, and A. Rosch, Emergent electrodynamics of skyrmions in a chi ral magnet, Nature Physics 8, 301 (2012)

    2012

  42. [56]

    Iwasaki, M

    J. Iwasaki, M. Mochizuki, and N. Nagaosa, Universal current-velocity r elation of skyrmion motion in chiral magnets, Nature Communications 4, 1463 (2013)

    2013

  43. [57]

    Iwasaki, M

    J. Iwasaki, M. Mochizuki, and N. Nagaosa, Current-induced skyrmion dy namics in constricted geometries, Nature Nanotechnology 8, 742 (2013)

    2013

  44. [58]

    Tatara and H

    G. Tatara and H. Fukuyama, Phasons and excitations in skyrmion lattice, J ournal of the Physical Society of Japan 83, 104711 (2014)

    2014

  45. [59]

    Nagaosa, Emergent inductor by spiral magnets, Japanese Journal of Applied P hysics 58, 120909 (2019)

    N. Nagaosa, Emergent inductor by spiral magnets, Japanese Journal of Applied P hysics 58, 120909 (2019)

    2019

  46. [60]

    Kurebayashi and N

    D. Kurebayashi and N. Nagaosa, Electromagnetic response in spiral magnets an d emergent inductance, Communications Physics 4, 260 (2021)

    2021

  47. [61]

    Lemesh, K

    I. Lemesh, K. Litzius, M. B¨ ottcher, P. Bassirian, N. Kerber, D. Heinze, J. Z´ azvorka, F. B¨ uttner, L. Caretta, M. Mann, M. Weigand, S. Finizio, J. Raabe, M.-Y. Im, H. Stoll, G. Sch¨ utz, B. Dup´ e, M. Kl¨ aui, and G. S. D. Beach, Current-induced skyrmion generation through...

    2018

  48. [62]

    Furuta, W

    S. Furuta, W. Koshibae, and F. Kagawa, Symmetry of the emergent induc tance tensor exhib- ited by magnetic textures, npj Spintronics 1, 3 (2023). 17

    2023

  49. [63]

    Furuta, W

    S. Furuta, W. Koshibae, K. Matsuura, N. Abe, F. Wang, S. Zhou, T.-h. Arim a, and F. Kagawa, Reconsidering nonlinear emergent inductance: Time-varying joule heating and its impact on AC electrical response, Physical Review B 110, 174402 (2024)

    2024

  50. [64]

    T. Sato, W. Koshibae, A. Kikkawa, Y. Taguchi, N. Nagaosa, Y. Tokura, and F. Kagawa, Non- thermal current-induced transition from skyrmion lattice to nontop ological magnetic phase in spatially confined MnSi, Physical Review B 106, 144425 (2022). 18

    2022

Pith tools

Reviewed August 7, 2026 · model on record in the stance chip above.