Pith. sign in

REVIEW 2 major objections 2 minor 54 references

Nonlocal Sensing Drives Hybrid Phase Separation in Brownian Matter

T0 review · 2 major / 2 minor · reviewed 2026-06-26 · grok-4.3

Pith's one-line read Nonlocal density sensing in Brownian particles produces hybrid phase separation with ordered internal microstructures selected by the sensing kernel.

desk verdict Nonlocal sensing in a minimal Brownian model produces hybrid phase separation with internal microstructure via a cascade of instabilities, but the stochastic interpretation of the density-dependent diffusivity needs explicit checking to rule out hidden drifts. read the letter →

arxiv 2606.21464 v1 pith:3FQ2ZVVQ submitted 2026-06-19 cond-mat.soft cond-mat.stat-mechphysics.bio-ph

classification cond-mat.softcond-mat.stat-mechphysics.bio-ph
keywords nonlocalsensingBrownianparticleshybridphaseseparationnonequilibriummatterinstabilityspectrumperceptionkernelfinite-wavelengthpatterning
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Particles that move solely by Brownian motion organize when their diffusion rate depends on the local density sensed over a finite range rather than at a single point. Local sensing yields only conventional long-wavelength demixing, but a finite perception zone restructures the instability spectrum to favor specific wavelengths and triggers nonlinear bubbling inside emerging domains. The outcome is hybrid phase separation: a macroscopic dense phase coexists with a dilute background, yet the dense regions retain internal order whose symmetry, anisotropy, and length scales are fixed by the shape of the perception kernel. This matters because it isolates information acquisition as a standalone organizing principle that controls both when phases appear and the dynamical route they follow.

What carries the argument

The perception kernel, which specifies the finite spatial range over which particles sense density to regulate their diffusivity.

What would settle it

A numerical simulation or experiment with purely local sensing (zero perception range) produces only long-wavelength demixing without internal patterns or bubbles, while introducing a finite perception range immediately generates finite-wavelength modes and void bubbles inside dense domains.

Watch

Extended reading notes

Core claim

In a minimal model of perceptive Brownian particles whose only coupling is informational—diffusivity regulated by density measured over a finite perception zone—nonlocal sensing restructures the instability spectrum. It introduces finite-wavelength patterning instabilities and nonlinear bubbling instabilities that follow a cascade: macroscopic demixing first creates dense domains, finite-wavelength modes then pattern those domains internally, and nonlinear feedback subsequently hollows them into void bubbles. The resulting hybrid phase separation features a macroscopic dense phase coexisting with a dilute background while the dense phase retains ordered microstructure whose symmetry, anisotr

Load-bearing premise

Particles undergo purely Brownian motion with no mechanical interactions, self-propulsion, alignment, or auxiliary fields, and couple only through informational regulation of diffusivity by sensed density.

Editorial extensions

If this is right

  • Macroscopic dense domains form but contain internal finite-wavelength patterns whose wavelength is set by the perception kernel.
  • Nonlinear feedback inside dense domains produces void bubbles, creating a hybrid coexistence state.
  • The symmetry and anisotropy of the internal microstructure are dictated by the functional form of the perception kernel.
  • The ordering pathway is a cascade of instabilities rather than a single demixing event.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Similar nonlocal-sensing mechanisms could operate in biological collectives where individuals respond to density sensed over a characteristic distance.
  • Varying the perception kernel shape in simulations could map transitions between conventional and hybrid phase separation.
  • The same informational coupling might be engineered in active-matter or robotic systems to control internal ordering without direct forces.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The manuscript introduces a minimal model of perceptive Brownian particles whose diffusivity D is regulated solely by the density measured over a finite nonlocal perception zone. It claims that this nonlocal sensing alone restructures the linear instability spectrum (introducing finite-wavelength modes) and triggers a cascade of nonlinear instabilities (including bubbling), producing hybrid phase separation: macroscopic dense domains coexist with a dilute background while retaining internally ordered microstructure whose symmetry, anisotropy, and length scales are selected by the perception kernel. The model is asserted to have purely informational coupling with no mechanical interactions, self-propulsion, or auxiliary fields.

Significance. If the central claims hold after clarification of the stochastic interpretation, the work would demonstrate that information acquisition can serve as a constitutive organizing principle for nonequilibrium matter, capable of selecting both phase stability and dynamical pathways independently of forces. This isolates nonlocal sensing in a controlled setting and could inform models of biological collectives or synthetic active matter.

major comments (2)
  1. [Model section, Eq. (1)] Model section, Eq. (1) (the SDE dr = sqrt(2 D[rho_perceived(r)]) dW): the manuscript must explicitly state the stochastic calculus convention (Ito, Stratonovich, or anti-Ito). The Stratonovich interpretation generates an additional spurious drift term proportional to ∇D that constitutes an effective mechanical force; this would violate the central assertion that coupling is purely informational and that the restructured spectrum and hybrid separation arise from perception alone. This point is load-bearing for the entire claim.
  2. [Linear stability analysis (likely §3)] Linear stability analysis (likely §3): the dispersion relation obtained after Fourier transformation of the nonlocal kernel must be shown explicitly. Without the precise form of the growth rate σ(k) as a function of the perception-zone size and kernel shape, it is impossible to verify that finite-k instabilities are introduced by nonlocality rather than by an implicit local approximation or discretization artifact.
minor comments (2)
  1. Figure captions should explicitly label the perception kernel used in each panel and state the stochastic discretization scheme employed in the simulations.
  2. The abstract states that length scales are 'selected by the perception kernel'; a brief statement in the main text quantifying how the kernel moments enter the selected wavelength would improve readability.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for the careful reading and the two major comments, which identify points that require explicit clarification to strengthen the manuscript. We address each below and will revise accordingly.

read point-by-point responses
  1. Referee: [Model section, Eq. (1)] Model section, Eq. (1) (the SDE dr = sqrt(2 D[rho_perceived(r)]) dW): the manuscript must explicitly state the stochastic calculus convention (Ito, Stratonovich, or anti-Ito). The Stratonovich interpretation generates an additional spurious drift term proportional to ∇D that constitutes an effective mechanical force; this would violate the central assertion that coupling is purely informational and that the restructured spectrum and hybrid separation arise from perception alone. This point is load-bearing for the entire claim.

    Authors: We agree that the stochastic interpretation must be stated explicitly, as it is central to the claim of purely informational coupling. Our model uses the Itô convention, under which the multiplicative noise produces no spurious drift and the only effect of the perceived density is to modulate the diffusion coefficient. We will revise the Model section to state the Itô interpretation explicitly, cite the relevant stochastic calculus reference, and note that this choice eliminates any effective mechanical force. revision: yes

  2. Referee: [Linear stability analysis (likely §3)] Linear stability analysis (likely §3): the dispersion relation obtained after Fourier transformation of the nonlocal kernel must be shown explicitly. Without the precise form of the growth rate σ(k) as a function of the perception-zone size and kernel shape, it is impossible to verify that finite-k instabilities are introduced by nonlocality rather than by an implicit local approximation or discretization artifact.

    Authors: We will include the explicit dispersion relation σ(k) obtained from the Fourier transform of the nonlocal kernel in the revised linear stability section. The expression will be written as a function of wavevector k, perception-zone radius, and kernel shape, allowing direct verification that finite-k modes are destabilized solely by nonlocality. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; derivation self-contained from model definition

full rationale

The paper introduces a model of purely Brownian particles whose diffusivity depends on nonlocal perceived density, then derives consequences for instability spectra and hybrid phase separation directly from that definition. No equations reduce a claimed prediction to a fitted input by construction, no self-citations are invoked as load-bearing uniqueness theorems, and no ansatz is smuggled via prior work. The abstract and description present the finite-wavelength patterning and bubbling cascade as emergent from the stated stochastic dynamics without tautological redefinition. This is the normal case of an independent derivation; the skeptic concern about stochastic calculus conventions is a modeling assumption issue, not a circularity reduction.

Assumptions & free parameters 1 free parameters · 1 assumptions · 0 invented entities

The central claim rests on the modeling choice of informational coupling only, with the perception zone as a key scale; no independent evidence for the absence of other interactions is given in the abstract.

free parameters (1)
  • perception zone size and kernel shape
    Finite perception zone and its functional form control the selected length scales and symmetry in the hybrid phase separation.
assumptions (1)
  • domain assumption Particles undergo purely Brownian motion with diffusivity regulated solely by sensed density over a finite zone.
    This is the explicit minimal model assumption isolating nonlocal sensing as the sole organizing mechanism.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Nonlocal Sensing Drives Hybrid Phase Separation in Brownian Matter." pith.science (2026). https://pith.science/paper/3FQ2ZVVQ

@misc{pith2026260621464,
  author       = {Pith},
  title        = {Pith review of: Nonlocal Sensing Drives Hybrid Phase Separation in Brownian Matter},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/3FQ2ZVVQ}},
  note         = {Machine review of arXiv:2606.21464}
}
read the original abstract

Matter can organize not only through forces, but also through the information its constituents acquire from their surroundings. Here we use perceptive Brownian particles as a minimal model to isolate nonlocal sensing as an organizing principle for nonequilibrium matter. The particles undergo purely Brownian motion, with no mechanical interactions, self-propulsion, alignment, or auxiliary fields. Their only coupling is informational, through diffusivity regulated by density measured over a finite perception zone. Whereas local sensing, when unstable, produces conventional long-wavelength demixing, nonlocal perception restructures the instability spectrum, introducing finite-wavelength patterning and nonlinear bubbling instabilities. More fundamentally, it reshapes the ordering pathway by assembling a cascade of instabilities: macroscopic demixing creates dense domains, finite-wavelength modes pattern them internally, and nonlinear feedback hollows them into void bubbles. This produces hybrid phase separation, where a macroscopic dense phase coexists with a dilute background while retaining ordered internal microstructure, whose symmetry, anisotropy, and length scales are selected by the perception kernel. These results establish information acquisition as a constitutive principle of nonequilibrium matter, capable of governing both phase stability and the dynamical pathways through which order emerges.

Figures

Figures reproduced from arXiv: 2606.21464 by the authors.

Figure 1
Figure 1. c). Once r0 exceeds a critical value, nonlocal sens￾ing destabilizes the homogeneous state and opens two or￾dered regimes inaccessible to local perception. At lower ρ0, the system exhibits a multiscale ordering dynamics: dense clusters nucleate, hollow into bubble-bearing do￾mains, and coarsen by coalescence and Ostwald ripen￾ing [39, 40] (Fig. 1e, Vid. S1, and blue region in Fig. 1c). The final state consists of a … view at source ↗
Figure 2
Figure 2. FIG. 2 [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: FIG. 4 [PITH_FULL_IMAGE:figures/full_fig_p005_4.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

54 extracted references

  1. [1]

    Ramaswamy, Annual Review of Condensed Matter Physics1, 323 (2010)

    S. Ramaswamy, Annual Review of Condensed Matter Physics1, 323 (2010)

  2. [2]

    M. C. Marchetti, J.-F. Joanny, S. Ramaswamy, T. B. Liverpool, J. Prost, M. Rao, and R. A. Simha, Reviews of Modern Physics85, 1143 (2013)

  3. [3]

    Bechinger, R

    C. Bechinger, R. Di Leonardo, H. L¨ owen, C. Reichhardt, G. Volpe, and G. Volpe, Reviews of Modern Physics88, 045006 (2016)

  4. [4]

    I. D. Couzin, J. Krause, N. R. Franks, and S. A. Levin, Nature433, 513 (2005)

  5. [5]

    Vicsek, A

    T. Vicsek, A. Czir´ ok, E. Ben-Jacob, I. Cohen, and O. Shochet, Physical Review Letters75, 1226 (1995)

  6. [6]

    Toner and Y

    J. Toner and Y. Tu, Physical Review Letters75, 4326 (1995)

  7. [7]

    H. H. Wensink, J. Dunkel, S. Heidenreich, K. Drescher, R. E. Goldstein, H. L¨ owen, and J. M. Yeomans, Pro- ceedings of the National Academy of Sciences109, 14308 (2012). 6

  8. [8]

    L´ opez, Physical Review E74, 012102 (2006)

    C. L´ opez, Physical Review E74, 012102 (2006)

Show all 54 references
  1. [9]

    Y. Zhou, Y. Li, and F. Marchesoni, National Science Open3, 20230081 (2024)

  2. [10]

    M. E. Cates and J. Tailleur, Annual Review of Condensed Matter Physics6, 219 (2015)

  3. [11]

    S. Li, T. V. Phan, L. Di Carlo, G. Wang, V. H. Do, E. Mikhail, R. H. Austin, and L. Liu, Physical Review Letters136, 138302 (2026)

  4. [12]

    VanSaders, M

    B. VanSaders, M. Fruchart, and V. Vitelli, PNAS Nexus 5, pgag077 (2026)

  5. [13]

    Tailleur and M

    J. Tailleur and M. E. Cates, Physical Review Letters100, 218103 (2008)

  6. [14]

    M. B. Miller and B. L. Bassler, Annual Review of Micro- biology55, 165 (2001)

  7. [15]

    C. M. Waters and B. L. Bassler, Annual Review of Cell and Developmental Biology21, 319 (2005)

  8. [16]

    Fischer, F

    A. Fischer, F. Schmid, and T. Speck, Physical Review E 101, 012601 (2020)

  9. [17]

    Dinelli, J

    A. Dinelli, J. O’Byrne, and J. Tailleur, Journal of Physics A: Mathematical and Theoretical57, 395002 (2024)

  10. [18]

    Y. Zhou, Q. Yin, S. Nayak, P. Bag, P. K. Ghosh, Y. Li, and F. Marchesoni, PNAS Nexus4, pgaf373 (2025)

  11. [19]

    Y. Zhou, Y. Li, and F. Marchesoni, Chinese Physics Let- ters40, 100505 (2023)

  12. [20]

    Lefranc, A

    T. Lefranc, A. Dinelli, C. Fern´ andez-Rico, R. P. Dullens, J. Tailleur, and D. Bartolo, Physical Review X15, 031050 (2025)

  13. [21]

    M. Rein, N. Heinß, F. Schmid, and T. Speck, Physical Review Letters116, 058102 (2016)

  14. [22]

    E. F. Keller and L. A. Segel, Journal of Theoretical Bi- ology30, 225 (1971)

  15. [23]

    Golestanian, Physical Review Letters108, 038303 (2012)

    R. Golestanian, Physical Review Letters108, 038303 (2012)

  16. [24]

    S. Saha, R. Golestanian, and S. Ramaswamy, Physical Review E89, 062316 (2014)

  17. [25]

    Pohl and H

    O. Pohl and H. Stark, Physical Review Letters112, 238303 (2014)

  18. [26]

    Liebchen, D

    B. Liebchen, D. Marenduzzo, and M. E. Cates, Physical Review Letters118, 268001 (2017)

  19. [27]

    F. C. Thewes, Y. Qiang, O. W. Paulin, and D. Zwicker, Physical Review Research8, L022023 (2026)

  20. [28]

    Ballerini, N

    M. Ballerini, N. Cabibbo, R. Candelier, A. Cavagna, E. Cisbani, I. Giardina, V. Lecomte, A. Orlandi, G. Parisi, A. Procaccini, M. Viale, and V. Zdravkovic, Proceedings of the National Academy of Sciences105, 1232 (2008)

  21. [29]

    Liu and M

    Z. Liu and M. Dijkstra, Soft Matter21, 1529 (2025)

  22. [30]

    F. A. Lavergne, H. Wendehenne, T. B¨ auerle, and C. Bechinger, Science364, 70 (2019)

  23. [31]

    R. S. Negi, R. G. Winkler, and G. Gompper, Physical Review Research6, 013118 (2024)

  24. [32]

    Saavedra and F

    R. Saavedra and F. Peruani, Physical Review E110, 064602 (2024)

  25. [33]

    Burger, J

    M. Burger, J. Haˇ skovec, and M.-T. Wolfram, Physica D: Nonlinear Phenomena260, 145 (2013)

  26. [34]

    Leibler, Macromolecules13, 1602 (1980)

    L. Leibler, Macromolecules13, 1602 (1980)

  27. [35]

    Ohta and K

    T. Ohta and K. Kawasaki, Macromolecules19, 2621 (1986)

  28. [36]

    Seul and D

    M. Seul and D. Andelman, Science267, 476 (1995)

  29. [37]

    Rubenstein, A

    M. Rubenstein, A. Cornejo, and R. Nagpal, Science345, 795 (2014)

  30. [38]

    M. A. Fernandez-Rodriguez, F. Grillo, L. Alvarez, M. Rathlef, I. Buttinoni, G. Volpe, and L. Isa, Nature Communications11, 4223 (2020)

  31. [39]

    I. M. Lifshitz and V. V. Slyozov, Journal of Physics and Chemistry of Solids19, 35 (1961)

  32. [40]

    Wagner, Zeitschrift f¨ ur Elektrochemie65, 581 (1961)

    C. Wagner, Zeitschrift f¨ ur Elektrochemie65, 581 (1961)

  33. [41]

    J. W. Cahn and J. E. Hilliard, The Journal of Chemical Physics28, 258 (1958)

  34. [42]

    A. J. Bray, Advances in Physics43, 357 (1994)

  35. [43]

    D. S. Dean, Journal of Physics A: Mathematical and Gen- eral29, L613 (1996)

  36. [44]

    P. C. Hohenberg and B. I. Halperin, Reviews of Modern Physics49, 435 (1977)

  37. [45]

    Wittkowski, A

    R. Wittkowski, A. Tiribocchi, J. Stenhammar, R. J. Allen, D. Marenduzzo, and M. E. Cates, Nature Com- munications5, 4351 (2014)

  38. [46]

    M. C. Cross and P. C. Hohenberg, Reviews of Modern Physics65, 851 (1993)

  39. [47]

    S. A. Brazovskii, Soviet Physics JETP41, 85 (1975)

  40. [48]

    C. M. Topaz, A. L. Bertozzi, and M. A. Lewis, Bulletin of Mathematical Biology68, 1601 (2006)

  41. [49]

    T. J. Jewell, A. L. Krause, P. K. Maini, and E. A. Gaffney, Mathematical Biosciences366, 109093 (2023)

  42. [50]

    Nardini, ´E

    C. Nardini, ´E. Fodor, E. Tjhung, F. van Wijland, J. Tailleur, and M. E. Cates, Physical Review X7, 021007 (2017)

  43. [51]

    Nonlocal Sensing Drives Hybrid Phase Separation in Brownian Matter

    E. Tjhung, C. Nardini, and M. E. Cates, Physical Review X8, 031080 (2018). ACKNOWLEDGEMENTS ZY was supported by the National Key Research and Development Program of China (No. 2023YFA1407500), the National Natural Science Foundation of China No. 12374219, the 111 project (B160...

  44. [52]

    P. E. Kloeden and E. Platen,Numerical Solution of Stochastic Differential Equations(Springer, Berlin, Heidelberg, 1992)

  45. [53]

    D. S. Dean, Journal of Physics A: Mathematical and General29, L613 (1996)

  46. [54]

    R. L. Burden, J. D. Faires, and A. M. Burden,Numerical Analysis(Cengage Learning, 2015)

Pith tools

Reviewed June 26, 2026 · model on record in the stance chip above.