Pith. sign in

REVIEW 13 cited by

An approach to computing spectral shifts for black holes beyond Kerr

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2206.10653 v1 pith:27EMOJSU submitted 2022-06-21 gr-qc

classification gr-qc
keywords blackholesringdownapproachrelativityshiftskerrspectral
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Recent measurements of gravitational-wave ringdown following the merger of binary black holes raise the prospect of precision black hole spectroscopy in the near future. To perform the most sensitive tests of the nature of black holes using ringdown measurements, it is critical to compute the deviations to the spectrum of black holes in particular extensions of relativity. These spectral shifts are also needed to interpret any violations of the predictions of relativity that may be detected during ringdown. Here we present a first step towards computing the shifts to the spectrum of Kerr black holes with arbitrary spins, by deriving a modified Teukolsky equation governing the perturbations of black holes in theories beyond GR. Our approach applies to a class of theories which includes dynamical Chern-Simons gravity and shift-symmetric scalar Gauss-Bonnet gravity, in the case where the deviations from relativity are small. This allows for a perturbative approach to solving the equations of motion. Further, we show how to use the modified equation to compute the leading-order spectral shifts of Kerr black holes, using eigenvalue perturbation methods. Our formalism provides a practical approach to predicting ringdown for black holes in a range of promising extensions to relativity, enabling future precision searches for their signatures in black hole ringdown.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 13 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Schr\"odinger perturbation theory for black hole quasinormal modes

    gr-qc 2026-07 conditional novelty 7.0 of 10

    A bilinear-form framework computes black-hole quasinormal-mode frequency shifts to any order, but the mode-sum expansion of the first-order mode shift diverges and needs a continuum piece.

  2. Parametrized beyond-Teukolsky framework in the time domain

    gr-qc 2026-07 conditional novelty 6.0 of 10

    First time-domain implementation of the parametrized beyond-Teukolsky framework, validated against frequency-domain benchmarks for low multipoles and yielding new amplitude, phase, quadratic-coefficient, and tail-onse...

  3. Computing spectral shifts for Johannsen-Psaltis black holes

    gr-qc 2025-12 conditional novelty 6.0 of 10

    Slowly rotating Johannsen–Psaltis black holes have definite-parity quasinormal modes with even/odd frequency shifts split by the deviation parameter, computed here through ℓ=10.

  4. Extreme mass-ratio inspiral within an ultralight scalar cloud I. Scalar radiation

    gr-qc 2025-07 conditional novelty 6.0 of 10

    Scalar radiation from an EMRI in an ultralight scalar cloud is computed semi-analytically, showing dipole clouds decelerate and quadrupole clouds accelerate the inspiral, with up to about 100 rad dephasing after 18 months.

  5. Black hole ringdown spectroscopy of curvature-coupled scalar and pseudoscalar fields

    gr-qc 2025-06 conditional novelty 6.0 of 10

    No quadratic-gravity ringdown signature is found in GW150914, GW190521, and GW200129, yielding 90% upper limits on coupling length scales of about 34 km for axi-dilaton, 49 km for dynamical Chern-Simons, and 47 km for...

  6. Bound States of the Schwarzschild Black Hole

    gr-qc 2025-05 conditional novelty 6.0 of 10

    The bound states of the inverted Regge-Wheeler potential are exponentially condensed near zero energy and strongly delocalized, linking black hole overtone instability to long-range potential features.

  7. Quasi-normal modes of slowly-rotating Johannsen black holes

    gr-qc 2024-12 conditional novelty 6.0 of 10

    For slowly rotating Johannsen black holes, the deformation parameter alpha_13 dominates the quasi-normal mode shifts, and ringdown data from GW170104 bound it to be consistent with zero.

  8. Ringdown Analysis of Rotating Black Holes in Effective Field Theory Extensions of General Relativity

    gr-qc 2024-11 conditional novelty 6.0 of 10

    No evidence of higher-derivative EFT corrections in black hole ringdown spectra from GWTC-3; new physics length scale constrained to ℓ ≲ 35 km.

  9. On-shell approach to scalar hair in spinning binaries

    hep-th 2024-11 conditional novelty 6.0 of 10

    Scalar hair on spinning compact objects is described by a conformal coupling of matter to a massless scalar, yielding matching waveforms and energy loss formulas for scalar-tensor gravity binaries.

  10. Discrete symmetries of modified Teukolsky equations

    gr-qc 2026-07 conditional novelty 5.0 of 10

    Complex modifications of the Teukolsky potential break m=0 QNM degeneracy and can inject non-physical mode branches when frequency-domain multipole-dependent potentials are evolved in time.

  11. Constraining deviations from the Teukolsky equation with GW250114

    gr-qc 2026-07 conditional novelty 5.0 of 10

    GW250114's fundamental ringdown mode bounds theory-agnostic deviations from the Teukolsky equation to be consistent with zero at characteristic scales of 60-100 km.

  12. Extreme mass-ratio inspirals and extra dimensions: Insights from modified Teukolsky framework

    gr-qc 2025-07 conditional novelty 5.0 of 10

    A modified Teukolsky equation and the Dudley-Finley approximation give nearly the same LISA detectability bound for the braneworld tidal charge, with MTE mismatches growing faster for high-eccentricity EMRIs.

  13. Can We Detect Deviations from Einstein's Gravity in Black Hole Ringdowns?

    gr-qc 2024-11 conditional novelty 4.0 of 10

    Higher-derivative corrections to black hole ringdown spectra and quadratic modes are either absent or suppressed below detectability once causality is enforced, leaving Einstein's gravity as the sole observable description.

Pith tools