Pith. sign in

REVIEW 3 major objections 4 minor 1 cited by

Tame Complexity of Effective Field Theories in the Quantum Gravity Landscape

T0 review · 3 major / 4 minor · reviewed 2026-08-03 · deepseek-v4-flash

Pith's one-line read Quantum gravity may impose a finite information ceiling on every consistent effective field theory.

desk verdict A genuinely useful framework paper that packages sharp o-minimality into finite-complexity conjectures for EFTs; the global version rests on openly flagged open problems, so read it as a program, not a proof. read the letter →

arxiv 2601.18863 v3 pith:DLN7KO7T submitted 2026-01-26 hep-th math-phmath.LOmath.MPquant-ph

classification hep-thmath-phmath.LOmath.MPquant-ph MSC 03C6414P1083E30 PACS 11.25.-w04.60.-m
keywords effectivefieldtheoryquantumgravitylandscapeswamplandtamegeometryo-minimalstructurescomplexityfinitenessstringcompactification
open problems Quantum Gravity
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Effective field theories consistent with quantum gravity are usually presented as infinite lists of Wilson coefficients; this paper argues that the expansion is an artifact of presentation and that the underlying theory can be repackaged into finitely much information. It introduces tame complexity — a pair of integers (format and degree) measuring the information content of a tame set or function — and proposes the Finite Complexity Conjecture in a local form (each such EFT has finite tame complexity) and a global form (at fixed dimension and cutoff Λ, the whole landscape of valid EFTs has a uniform complexity bound and the set itself is tame). The claim would matter because it upgrades qualitative finiteness expectations in the quantum-gravity landscape into quantitative, computable bounds, and because it makes counting EFTs and defining volume-weighted measures on parameter spaces mathematically well-defined. The paper supports the conjecture with exact examples where infinite series are resummed by differential equations, and it is explicit that the preservation of tameness under exact renormalization-group flow is not yet proven.

What carries the argument

The load-bearing object is the tame-complexity pair (F,D) from sharp o-minimality: F counts the basic format of the logical description, D controls polynomial-like complexity, and axioms ensure that numbers of connected components and other geometric features are bounded by a polynomial in D depending on F. The mechanism that compresses infinite Wilson data is a finite system of differential constraints — a Pfaffian or Log-Noetherian chain — through which all higher-order couplings are determined by finitely many parameters. Because a single EFT action need not be valid globally over moduli space, the paper introduces EFT domains and EFT coverings: finitely many regions, each with a local La

What would settle it

Take a tame initial potential and run the exact Wilsonian RG equation in the local potential approximation; if for some finite Λ the effective potential develops infinitely many oscillations in a bounded field interval, it is not definable in any o-minimal structure and the local conjecture fails for generic interacting scalars. Equivalently, exhibit any string- or M-theory vacuum whose exactly resummed two-derivative Lagrangian is provably non-definable in every sharply o-minimal structure.

Watch

Extended reading notes

Core claim

The central claim, the Finite Complexity Conjecture, says that quantum-gravity-consistent EFTs are information-finite. Locally, every such EFT has a description in which the two-derivative Lagrangian is definable in a sharply o-minimal structure, meaning it carries a finite tame complexity (F,D). Globally, for fixed spacetime dimension d and cutoff Λ, the set M_{QG;Λ} of all such EFTs is itself definable with finite complexity (F_Λ,D_Λ), and each member has a description with complexity bounded by that same pair. The evidence includes a zero-dimensional quantum field theory whose exact effective Lagrangian resums into a Pfaffian function, an N=2 supersymmetric gauge theory whose infinitely m

Load-bearing premise

The load-bearing premise is that exact renormalization-group flow sends tame potentials to tame potentials in a sharply o-minimal structure, plus the sharp o-minimality of Log-Noetherian period integrals; the paper explicitly flags the RG-flow part as not-yet-known, so the conjecture is hostage to a non-trivial extension of o-minimality to PDEs.

Editorial extensions

If this is right

  • An infinite Wilsonian expansion does not force infinite information: hidden differential or recursion relations can resum a landscape EFT into a finite-complexity object.
  • At fixed cutoff Λ, a single pair (F_Λ,D_Λ) bounds the complexity of every landscape EFT, sharpening finiteness-of-spectrum claims into quantitative bounds on fields and couplings.
  • The landscape set M_{QG;Λ} admits a finite EFT covering, so counting EFTs by minimal number of domains, and volume-weighted counts of flat directions, become finite and well-defined.
  • Infinite discrete vacuum families such as AdS5 × S5 with arbitrary flux N evade the global statement only in the Λ→0 limit; at any fixed cutoff only finitely many contribute, clarifying where tameness requires a cutoff.
  • Volume of any geodesic ball in a tame moduli space grows at most as C(F,D) r^κ, giving a complexity-controlled version of Euclidean growth and the compactifiability criterion.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If correct, the conjecture offers a practical swampland test: try to resum a candidate EFT's Wilson coefficients via a finite-order differential equation; failure to find any finite-complexity description would mark the theory as suspect.
  • A natural next step, left open by the paper, is to compute effective complexity for one-modulus Calabi-Yau compactifications and check the expected at-most-polynomial/logarithmic growth in 1/Λ.
  • The framework suggests a broader principle: whenever a physical description appears to need infinite data at finite resolution, the right dual description has not yet been found — a perspective that extends the argument beyond gravity.
  • If sharp o-minimality of Log-Noetherian functions fails, the period-integral examples would lose their complexity assignments, while the semi-algebraic and Pfaffian examples would still support a weakened, structure-dependent version of the conjecture.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. The paper develops a quantitative notion of 'tame complexity' for effective field theories, using sharp o-minimal structures to assign a pair of integers (format, degree) to tame sets and functions. It proposes a local Finite Complexity Conjecture: every EFT consistent with quantum gravity admits a finite-complexity description of its two-derivative Lagrangian; and a global Finite Complexity Conjecture: for fixed dimension and cutoff Λ, the set M_QG;Λ of such EFTs is definable in a sharply o-minimal structure with finite complexity (F_Λ,D_Λ), and every such EFT has complexity bounded by (F_Λ,D_Λ). The supporting evidence consists of a 0d QFT example with Pfaffian effective potential, the Seiberg-Witten prepotential as a Log-Noetherian function, and arithmetic quotients Γ\G/K from supergravity as semi-algebraic tame manifolds. The paper also introduces EFT domains and coverings to handle moduli-space locality, and connects complexity bounds to volume growth and counting of vacua. The authors are explicit that several key mathematical ingredients — tameness of exact RG flow and sharp o-minimality of R_LN — remain open.

Significance. If the conjectures hold, the framework would give a precise, quantitative form of finiteness in the quantum gravity landscape, unifying spectrum finiteness, Wilson-coefficient constraints, and moduli-space volume bounds under a single definability/complexity principle. The paper's definitions are careful, and the worked examples are genuinely non-trivial: the 0d Pfaffian resummation, the Seiberg-Witten differential-equation description, and the tameness of arithmetic quotients are concrete and independently checkable. The connection to counting via Hausdorff measure and the polynomial-in-log-Λ bound is a useful step toward making swampland finiteness quantitative. The main value is as a well-formulated conjecture framework with illustrative evidence rather than a proof; its significance depends on the conjectural mathematical foundations being eventually supplied.

major comments (3)
  1. [§3.1, Eq. (28); §4.1] The local Finite Complexity Conjecture applies to every EFT consistent with quantum gravity, including generic non-supersymmetric interacting 4d theories. The only mechanism proposed for such cases is preservation of tameness under the Wegner-Houghton exact RG flow, but the paper states that 'precise details on partial differential equations of this type and o-minimality are presently not known'. The worked examples are 0d (where the path integral is finite-dimensional) or supersymmetric (where holomorphy controls the effective action). Neither covers the generic interacting case. As stated, the central claim lacks a demonstrated mechanism; this is not a contradiction, but it is load-bearing. The authors should either prove tameness preservation for a non-trivial class (e.g. LPA Wegner-Houghton with polynomial initial potentials) or explicitly narrow the local conjecture to the classes f
  2. [§2.2, §4.2; §3.1 Seiberg-Witten example] The finite-complexity statement for period integrals and for the Seiberg-Witten prepotential depends on the conjecture that R_LN is sharply o-minimal and admits an FD-filtration. The paper itself notes that the proper FD-filtration 'is not currently known' and that only an effective format exists. Consequently, the Seiberg-Witten example does not yet establish definability in a sharply o-minimal structure with a finite (F,D) pair; it establishes Log-Noetherian definability in an o-minimal sense and an effective complexity. The conjectures in §4.1 require sharp o-minimality. Please state this gap explicitly in the example and in §4.2, and separate the conditional conclusion from the proven part.
  3. [§4.1, Finite Complexity Conjecture part (i)] Part (i) is not a fully well-posed mathematical statement because M_QG;Λ is not defined with a precise equivalence relation on EFTs, nor with a construction of the space as a definable object. The paper acknowledges that 'its precise definition will require to address several important points, e.g. when two EFTs are considered to be equivalent'. Without such a definition, the conjecture cannot be tested or refuted in specific examples. The authors should provide a formal definition of M_QG;Λ (or at least a concrete inductive definition for a restricted class, e.g. scalar EFTs with a fixed field content) and specify the equivalence relation, so that the conjecture has definite content.
minor comments (4)
  1. [Throughout] Several typos and formatting issues: 'T riangulation' in §2.1, 'arisng' in the Introduction, 'mininum' in §4.1, 'taken the slice' in §2.2, and inconsistent use of 'F_EFT' vs 'F_EFT' in the conjecture statement.
  2. [§3.1, Eq. (23)] The expression for a_{2n} is described as an asymptotic series but is written in terms of an infinite sum over k; clarify whether the equality is formal, and specify the sense in which the sequence is reorganized by the exact expression (25).
  3. [§4.3, Eq. (49)] The notation C(F,D) and C(F,D) is used for different coefficients; the distinction is not always clear. Please use distinct symbols, for example C and \tilde C.
  4. [References] Reference [97] is a Master's thesis; if a published version exists, it would be preferable. Also, reference [98] appears twice (once as [98] and once as [95] with the same title); please merge or differentiate.

Circularity Check

0 steps flagged · score 2.0 of 10

No significant circularity: the central claims are explicitly conjectural, and the supporting examples rest on external mathematics; self-citations are present but not load-bearing.

full rationale

The Finite Complexity Conjecture is explicitly presented as a conjecture rather than as a derivation from its own definitions. The central repackaging mechanism, exact RG flow, is openly flagged as unproven: the paper states 'Precise details on partial differential equations of this type and o-minimality are presently not known, and it is likely that a non-trivial mathematical extension is required to describe the tameness of exact RG flows.' That is an honest open premise, not a circular substitution. The local conjecture is motivated by the external finiteness claim [85] and by the authors' own Tameness Conjectures [17,20], but it is formulated as a strengthening of those conjectures rather than reduced to them. No parameter is fitted to data and then renamed as a prediction; the complexity pairs (F_EFT,D_EFT) and (F_Λ,D_Λ) are not computed from themselves. The worked examples are supported by explicit differential equations and external results (e.g. Matone [58], Bakker–Klingler–Tsimerman [95], Binyamini [38]), and the sharp o-minimality of R_LN is itself labelled conjectural. Self-citations such as [25,27,39,87] provide illustrative complexity computations and further motivation, but the global claim does not depend on a single self-referential equation or on a self-cited uniqueness theorem. I therefore find no circular step that makes the central claim equivalent to its inputs.

Assumptions & free parameters 0 free parameters · 8 assumptions · 1 invented entities

The central claim rests not on numeric free parameters fitted to data, but on several unproved mathematical and physical premises: sharp o-minimality of R_LN, tameness of exact RG flow, swampland finiteness and distance conjectures, and the assumed finiteness of compact Calabi-Yau threefolds. These are mostly acknowledged by the authors. No fitted numerical constants enter the derivation, but the unresolved premises are load-bearing.

assumptions (8)
  • standard math Axioms of o-minimal structures (closure under projections, complements, products, algebraic sets, one-dimensional finiteness)
    Basis of the tameness framework in §2.1; unproved background taken from [29].
  • standard math Existence of an FD-filtration and sharp o-minimality for R_alg (semi-algebraic sets)
    R_alg is sharply o-minimal; used to assign complexity to arithmetic quotients and supergravity Lagrangians in §2.2 and §4.2.
  • domain assumption Sharp o-minimality of the Log-Noetherian structure R_LN
    Only conjectured (§2.2); needed for period integrals, Seiberg-Witten data, and RG-flow expectations (§3.1, §4.2).
  • domain assumption Tameness of exact RG flow (Wegner-Houghton LPA) preserves definability
    Explicitly stated as unknown in §3.1: 'Precise details ... are presently not known'. Required for finite-complexity descriptions of interacting higher-dimensional EFTs.
  • domain assumption Quantum gravity imposes finiteness of light spectra and finitely many Wilson parameters
    Used to motivate the local FCC in §4.1; based on swampland conjectures, including [85], rather than proven theorems.
  • domain assumption Distance Conjecture: r_max ~ (1/α)|log Λ|
    Used to convert volume bounds into polynomial-in-log-Λ EFT counts in §4.3, equations (51)-(52).
  • domain assumption Finiteness of compact Calabi-Yau threefolds (up to transitions)
    Invoked in §4.2 as a consistency argument; cited as claimed/progressed, not a proven general theorem.
  • domain assumption Existence of isometric sharply o-minimal embeddings of moduli-space components into Euclidean space
    The volume-growth argument in §4.3 assumes such embeddings; the paper notes no intrinsic complexity theory for Riemannian manifolds exists.
invented entities (1)
  • EFT domains and EFT coverings
    purpose: To localize finite-complexity Lagrangian descriptions over parameter/moduli space and to define counting of EFTs
    New formal constructions introduced in §3.2; no external falsifiable prediction but well-defined organizing tools.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Tame Complexity of Effective Field Theories in the Quantum Gravity Landscape." pith.science (2026). https://pith.science/paper/DLN7KO7T

@misc{pith2026260118863,
  author       = {Pith},
  title        = {Pith review of: Tame Complexity of Effective Field Theories in the Quantum Gravity Landscape},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/DLN7KO7T}},
  note         = {Machine review of arXiv:2601.18863}
}
read the original abstract

Effective field theories consistent with quantum gravity obey surprising finiteness constraints, appearing in several distinct but interconnected forms. In this work we develop a framework that unifies these observations by proposing that the defining data of such theories, as well as the landscape of effective field theories that are valid at least up to a fixed cutoff, admit descriptions with a uniform bound on complexity. To make this precise, we use tame geometry and work in sharply o-minimal structures, in which tame sets and functions come with two integer parameters that quantify their information content; we call this pair their tame complexity. Our Finite Complexity Conjectures are supported by controlled examples in which an infinite Wilsonian expansion nevertheless admits an equivalent finite-complexity description, typically through hidden rigidity conditions such as differential or recursion relations. We further assemble evidence from string compactifications, highlighting the constraining role of moduli space geometry and the importance of dualities. This perspective also yields mathematically well-defined notions of counting and volume measures on the space of effective theories, formulated in terms of effective field theory domains and coverings, whose finiteness is naturally enforced by the conjectures.

Figures

Figures reproduced from arXiv: 2601.18863 by the authors.

Figure 1
Figure 1. An example of a tame set X ⊆ R 2 (left) and a cylindrical cell decomposition of R 2 adapted to X (right). The vertical boundaries of the cells ensure that the cell decomposition behaves appropriately under the linear projection to the horizontal axis. Tame geometry. The definition of o-minimality provides a tameness axiom for sub￾sets of R n for any n. It is possible to go beyond this, and generalize to a framework … view at source ↗
Figure 2
Figure 2. EFT covering of N = 2 SU(2) Seiberg-Witten moduli space with finitely many EFT domains (discs and punctured discs). Around each of the three infinite distant limits there exists a different EFT description of finite complexity in terms of different combinations of variables a and aD, capturing the electric-magnetic duality discussed in [52]. In addition, three other discs centered around regular points are included … view at source ↗
Figure 3
Figure 3. figure 3. It is inside this patch where there exists a well-defined Lagrangian description [PITH_FULL_IMAGE:figures/full_fig_p027_3.png] view at source ↗
Figures from the paper (4 more)
Figure 4
Figure 4. Figure 4: Depiction of the moduli space MΛ of Type IIB supergravity in 10 dimensions as a subset of the hyperbolic plane. The solid blue lines depict the boundaries of the fundamental domain of H/SL(2, Z). The region of the fundamental domain where the EFT supergravity descripti…
Figure 5
Figure 5. Figure 5: Shape of the moduli space MΛ of the 9-dimensional theory obtained from compactifying M-theory on a torus for different values of Λ (in 9-dimensional Planck units). The moduli space has been parametrized using the volume of the torus U = R10R11 and its complex structure…
Figure 6
Figure 6. Figure 6: Depiction of the moduli space near a conifold transition between two topo [PITH_FULL_IMAGE:figures/full_fig_p032_6.png]
Figure 7
Figure 7. Figure 7: A segment Bb1 (r) of length 2r (in red) of the embedded curve Mc inside an Euclidean disk of radius r, corresponding to κ = 1 and N = 2. The curve is bent strongly and occupies a subdisk of smaller radius than Mcr = M ∩ c B2 (r) ensuring the length of Bb1 (r) is smalle…

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Complexity measures in holographic cascading theories with multiscale dynamics

    hep-th 2026-08 accept novelty 6.0 of 10

    In holographic B8 gauge theories, complexity growth flattens near a walking conformal regime, while Krylov oscillation periods track the infrared scale and persist in screened, non-confining phases.

Reference graph

Works this paper leans on

113 extracted references · 4 canonical work pages · cited by 1 Pith paper

  1. [1]

    The String landscape and the swampland,

    C. Vafa, “The String landscape and the swampland,”arXiv:hep-th/0509212

  2. [2]

    The Swampland: Introduction and Review,

    E. Palti, “The Swampland: Introduction and Review,”Fortsch. Phys.67no. 6, (2019) 1900037,arXiv:1903.06239 [hep-th]

  3. [3]

    Lectures on the Swampland Program in String Compactifications,

    M. van Beest, J. Calder´ on-Infante, D. Mirfendereski, and I. Valenzuela, “Lectures on the Swampland Program in String Compactifications,”Phys. Rept.989(2022) 1–50,arXiv:2102.01111 [hep-th]

  4. [4]

    Lectures on the string landscape and the Swampland,

    N. B. Agmon, A. Bedroya, M. J. Kang, and C. Vafa, “Lectures on the string landscape and the Swampland,”arXiv:2212.06187 [hep-th]

  5. [5]

    A Finite landscape?,

    B. S. Acharya and M. R. Douglas, “A Finite landscape?,” arXiv:hep-th/0606212

  6. [6]

    Global aspects of the space of 6D N = 1 supergravities,

    V. Kumar, D. R. Morrison, and W. Taylor, “Global aspects of the space of 6D N = 1 supergravities,”JHEP11(2010) 118,arXiv:1008.1062 [hep-th]

  7. [7]

    Swampland Bounds on the Abelian Gauge Sector,

    S.-J. Lee and T. Weigand, “Swampland Bounds on the Abelian Gauge Sector,” Phys. Rev. D100no. 2, (2019) 026015,arXiv:1905.13213 [hep-th]

  8. [8]

    Branes and the Swampland,

    H.-C. Kim, G. Shiu, and C. Vafa, “Branes and the Swampland,”Phys. Rev. D 100no. 6, (2019) 066006,arXiv:1905.08261 [hep-th]

Show all 113 references
  1. [9]

    Swampland Constraints on 5d N= 1 Supergravity,

    S. Katz, H.-C. Kim, H.-C. Tarazi, and C. Vafa, “Swampland Constraints on 5d N= 1 Supergravity,”JHEP07(2020) 080,arXiv:2004.14401 [hep-th]

  2. [10]

    On The Finiteness of 6d Supergravity Landscape,

    H.-C. Tarazi and C. Vafa, “On The Finiteness of 6d Supergravity Landscape,” arXiv:2106.10839 [hep-th]

  3. [11]

    Quantum gravity bounds onN= 1 effective theories in four dimensions,

    L. Martucci, N. Risso, and T. Weigand, “Quantum gravity bounds onN= 1 effective theories in four dimensions,”JHEP03(2023) 197,arXiv:2210.10797 [hep-th]

  4. [12]

    Finite Landscape of 6d N=(1,0) Supergravity,

    H.-C. Kim, C. Vafa, and K. Xu, “Finite Landscape of 6d N=(1,0) Supergravity,”arXiv:2411.19155 [hep-th]

  5. [13]

    Explicit Bounds on the Spectrum of 6d N=(1,0) Supergravity,

    C. Birkar and S.-J. Lee, “Explicit Bounds on the Spectrum of 6d N=(1,0) Supergravity,”arXiv:2507.06295 [hep-th]

  6. [14]

    On the Geometry of the String Landscape and the Swampland,

    H. Ooguri and C. Vafa, “On the Geometry of the String Landscape and the Swampland,”Nucl. Phys. B766(2007) 21–33,arXiv:hep-th/0605264. 42

  7. [15]

    Cobordism Classes and the Swampland,

    J. McNamara and C. Vafa, “Cobordism Classes and the Swampland,” arXiv:1909.10355 [hep-th]

  8. [16]

    Finiteness and the swampland,

    Y. Hamada, M. Montero, C. Vafa, and I. Valenzuela, “Finiteness and the swampland,”J. Phys. A55no. 22, (2022) 224005,arXiv:2111.00015 [hep-th]

  9. [17]

    Taming the landscape of effective theories,

    T. W. Grimm, “Taming the landscape of effective theories,”JHEP11(2022) 003,arXiv:2112.08383 [hep-th]

  10. [18]

    Finiteness for self-dual classes in integral variations of Hodge structure,

    B. Bakker, T. W. Grimm, C. Schnell, and J. Tsimerman, “Finiteness for self-dual classes in integral variations of Hodge structure,”arXiv:2112.06995 [math.AG]

  11. [19]

    The Tameness of Quantum Field Theory, Part I – Amplitudes,

    M. R. Douglas, T. W. Grimm, and L. Schlechter, “The Tameness of Quantum Field Theory, Part I – Amplitudes,”arXiv:2210.10057 [hep-th]

  12. [20]

    The Tameness of Quantum Field Theory, Part II – Structures and CFTs,

    M. R. Douglas, T. W. Grimm, and L. Schlechter, “The Tameness of Quantum Field Theory, Part II – Structures and CFTs,”arXiv:2302.04275 [hep-th]

  13. [21]

    Taming non-analyticities of QFT observables,

    T. W. Grimm, G. Ravazzini, and M. van Vliet, “Taming non-analyticities of QFT observables,”JHEP02(2025) 009,arXiv:2407.08815 [hep-th]

  14. [22]

    Sharply o-minimal structures and sharp cellular decomposition,

    G. Binyamini, D. Novikov, and B. Zack, “Sharply o-minimal structures and sharp cellular decomposition,”arXiv:2209.10972 [math.LO]

  15. [23]

    Tameness in geometry and arithmetic: beyond o-minimality,

    G. Binyamini and D. Novikov, “Tameness in geometry and arithmetic: beyond o-minimality,”EMS Press(12, 2023) 1440–1461

  16. [24]

    Quantum complexity in gravity, quantum field theory, and quantum information science,

    S. Baiguera, V. Balasubramanian, P. Caputa, S. Chapman, J. Haferkamp, M. P. Heller, and N. Y. Halpern, “Quantum complexity in gravity, quantum field theory, and quantum information science,”Phys. Rept.1159(2026) 1–77, arXiv:2503.10753 [hep-th]

  17. [25]

    Complexity in tame quantum theories,

    T. W. Grimm, L. Schlechter, and M. van Vliet, “Complexity in tame quantum theories,”JHEP05(2024) 001,arXiv:2310.01484 [hep-th]

  18. [26]

    Structure and Complexity of Cosmological Correlators,

    T. W. Grimm, A. Hoefnagels, and M. van Vliet, “Structure and Complexity of Cosmological Correlators,”arXiv:2404.03716 [hep-th]

  19. [27]

    On the complexity of quantum field theory,

    T. W. Grimm and M. van Vliet, “On the complexity of quantum field theory,” JHEP06(2025) 215,arXiv:2410.23338 [hep-th]

  20. [28]

    Counting AdS Vacua,

    Z. K. Baykara, A. Tomasiello, and C. Vafa, “Counting AdS Vacua,” arXiv:2512.04151 [hep-th]

  21. [29]

    van den Dries,Tame topology and o-minimal structures, vol

    L. van den Dries,Tame topology and o-minimal structures, vol. 248 ofLondon Mathematical Society Lecture Note Series. Cambridge University Press, Cambridge, 1998. 43

  22. [30]

    Tarski,A decision method for elementary algebra and geometry

    A. Tarski,A decision method for elementary algebra and geometry. University of California Press, Berkeley-Los Angeles, Calif., 1951. 2nd ed

  23. [31]

    On the theory of the real exponential field,

    A. J. Wilkie, “On the theory of the real exponential field,”Illinois Journal of Mathematics33no. 3, (1989) 384 – 408. https://doi.org/10.1215/ijm/1255988651

  24. [32]

    Projections of semi-analytic sets,

    A. M. Gabrielov, “Projections of semi-analytic sets,”Functional Analysis and its applications2no. 4, (1968) 282–291

  25. [33]

    A class of systems of transcendental equations,

    A. G. Hovanski ˘ ı, “A class of systems of transcendental equations,”Dokl. Akad. Nauk SSSRno. no. 4,, (1980) 804–807

  26. [34]

    Complexity of computations with Pfaffian and Noetherian functions,

    A. Gabrielov and N. Vorobjov, “Complexity of computations with Pfaffian and Noetherian functions,” inNormal forms, bifurcations and finiteness problems in differential equations, vol. 137 ofNATO Sci. Ser. II Math. Phys. Chem., pp. 211–250. Kluwer Acad. Publ., Dordrecht, 2004

  27. [35]

    A theorem of the complement and some new o-minimal structures,

    A. J. Wilkie, “A theorem of the complement and some new o-minimal structures,”Selecta Math. (N.S.)5no. 4, (1999) 397–421

  28. [36]

    A. G. Khovanskii,Fewnomials, vol. 88 ofTranslations of Mathematical Monographs. American Mathematical Society, Providence, RI, 1991. https://doi.org/10.1090/mmono/088

  29. [37]

    Effective cylindrical cell decompositions for restricted sub-Pfaffian sets,

    G. Binyamini and N. Vorobjov, “Effective cylindrical cell decompositions for restricted sub-Pfaffian sets,”Int. Math. Res. Not. IMRNno. 5, (2022) 3493–3510,arXiv:2004.06411 [math.AG]

  30. [38]

    Log-Noetherian functions,

    G. Binyamini, “Log-Noetherian functions,”arXiv:2405.16963 [math.AG]

  31. [39]

    On the Complexity of Effective Theories – Seiberg-Witten theory,

    M. Carrascal, F. Ellen, T. W. Grimm, and D. Prieto, “On the Complexity of Effective Theories – Seiberg-Witten theory,”arXiv:2512.11029 [hep-th]

  32. [40]

    Machine learning the breakdown of tame effective theories,

    S. Lanza, “Machine learning the breakdown of tame effective theories,”Eur. Phys. J. C84no. 6, (2024) 631,arXiv:2311.03437 [hep-th]

  33. [41]

    Neural network learning and Quantum Gravity,

    S. Lanza, “Neural network learning and Quantum Gravity,”JHEP07(2024) 105,arXiv:2403.03245 [hep-th]

  34. [42]

    The Computational Complexity of the Weak Gravity Conjecture,

    S. Lanza, “The Computational Complexity of the Weak Gravity Conjecture,” arXiv:2505.03868 [hep-th]

  35. [43]

    Renormalization group equation for critical phenomena,

    F. J. Wegner and A. Houghton, “Renormalization group equation for critical phenomena,”Phys. Rev. A8(1973) 401–412

  36. [44]

    The Effectiveness of the local potential approximation in the Wegner-Houghton renormalization group,

    K.-I. Aoki, K.-i. Morikawa, W. Souma, J.-i. Sumi, and H. Terao, “The Effectiveness of the local potential approximation in the Wegner-Houghton renormalization group,”Prog. Theor. Phys.95(1996) 409–420, arXiv:hep-ph/9612458. 44

  37. [45]

    Wegner-Houghton equation and derivative expansion,

    A. Bonanno, V. Branchina, H. Mohrbach, and D. Zappala, “Wegner-Houghton equation and derivative expansion,”Phys. Rev. D60(1999) 065009, arXiv:hep-th/9903173

  38. [46]

    The Pfaffian closure of an o-minimal structure,

    P. Speissegger, “The Pfaffian closure of an o-minimal structure,”J. Reine Angew. Math.508(1999) 189–211. https://doi.org/10.1515/crll.1999.026

  39. [47]

    Exact evolution equation for the effective potential,

    C. Wetterich, “Exact evolution equation for the effective potential,”Phys. Lett. B301(1993) 90–94,arXiv:1710.05815 [hep-th]

  40. [48]

    Nonperturbative evolution equation for quantum gravity,

    M. Reuter, “Nonperturbative evolution equation for quantum gravity,”Phys. Rev. D57(1998) 971–985,arXiv:hep-th/9605030

  41. [49]

    Ultraviolet fixed point and generalized flow equation of quantum gravity,

    O. Lauscher and M. Reuter, “Ultraviolet fixed point and generalized flow equation of quantum gravity,”Phys. Rev. D65(2002) 025013, arXiv:hep-th/0108040

  42. [50]

    Functional Renormalization Group Equations, Asymptotic Safety, and Quantum Einstein Gravity,

    M. Reuter and F. Saueressig, “Functional Renormalization Group Equations, Asymptotic Safety, and Quantum Einstein Gravity,” inFirst Quantum Geometry and Quantum Gravity School, pp. 288–329. 2010.arXiv:0708.1317 [hep-th]

  43. [51]

    Saueressig,The Functional Renormalization Group in Quantum Gravity

    F. Saueressig,The Functional Renormalization Group in Quantum Gravity. 2023.arXiv:2302.14152 [hep-th]

  44. [52]

    Electric - magnetic duality, monopole condensation, and confinement in N=2 supersymmetric Yang-Mills theory,

    N. Seiberg and E. Witten, “Electric - magnetic duality, monopole condensation, and confinement in N=2 supersymmetric Yang-Mills theory,”Nucl. Phys. B 426(1994) 19–52,arXiv:hep-th/9407087. [Erratum: Nucl.Phys.B 430, 485–486 (1994)]

  45. [53]

    Monopoles, duality and chiral symmetry breaking in N=2 supersymmetric QCD,

    N. Seiberg and E. Witten, “Monopoles, duality and chiral symmetry breaking in N=2 supersymmetric QCD,”Nucl. Phys. B431(1994) 484–550, arXiv:hep-th/9408099

  46. [54]

    Nonperturbative effective actions of N=2 supersymmetric gauge theories,

    A. Klemm, W. Lerche, and S. Theisen, “Nonperturbative effective actions of N=2 supersymmetric gauge theories,”Int. J. Mod. Phys. A11(1996) 1929–1974,arXiv:hep-th/9505150

  47. [55]

    Introduction to Seiberg-Witten theory and its stringy origin,

    W. Lerche, “Introduction to Seiberg-Witten theory and its stringy origin,” Nucl. Phys. B Proc. Suppl.55(1997) 83–117,arXiv:hep-th/9611190

  48. [56]

    Introduction to S duality in N=2 supersymmetric gauge theories: A Pedagogical review of the work of Seiberg and Witten,

    L. Alvarez-Gaume and S. F. Hassan, “Introduction to S duality in N=2 supersymmetric gauge theories: A Pedagogical review of the work of Seiberg and Witten,”Fortsch. Phys.45(1997) 159–236,arXiv:hep-th/9701069

  49. [57]

    Supersymmetry and Nonperturbative beta Functions,

    N. Seiberg, “Supersymmetry and Nonperturbative beta Functions,”Phys. Lett. B206(1988) 75–80

  50. [58]

    Instantons and recursion relations in N=2 SUSY gauge theory,

    M. Matone, “Instantons and recursion relations in N=2 SUSY gauge theory,” Phys. Lett. B357(1995) 342–348,arXiv:hep-th/9506102. 45

  51. [59]

    Effective field theories as Lagrange spaces,

    N. Craig, Y.-T. Lee, X. Lu, and D. Sutherland, “Effective field theories as Lagrange spaces,”JHEP11(2023) 069,arXiv:2305.09722 [hep-th]

  52. [60]

    Effective Field Theories on the Jet Bundle,

    N. Craig and Y.-T. Lee, “Effective Field Theories on the Jet Bundle,”Phys. Rev. Lett.132no. 6, (2024) 061602,arXiv:2307.15742 [hep-th]

  53. [61]

    A Bound on 6D N=1 supergravities,

    V. Kumar and W. Taylor, “A Bound on 6D N=1 supergravities,”JHEP12 (2009) 050,arXiv:0910.1586 [hep-th]

  54. [62]

    Matter and singularities,

    D. R. Morrison and W. Taylor, “Matter and singularities,”JHEP01(2012) 022,arXiv:1106.3563 [hep-th]

  55. [63]

    Constraints on 6D Supergravity Theories with Abelian Gauge Symmetry,

    D. S. Park and W. Taylor, “Constraints on 6D Supergravity Theories with Abelian Gauge Symmetry,”JHEP01(2012) 141,arXiv:1110.5916 [hep-th]

  56. [64]

    Structure in 6D and 4D N=1 supergravity theories from F-theory,

    T. W. Grimm and W. Taylor, “Structure in 6D and 4D N=1 supergravity theories from F-theory,”JHEP10(2012) 105,arXiv:1204.3092 [hep-th]

  57. [65]

    The moduli space of 3-folds with K=0 may nevertheless be irreducible,

    M. Reid, “The moduli space of 3-folds with K=0 may nevertheless be irreducible,”Mathematische Annalen278no. 1, (1987) 329–334

  58. [66]

    A survey of calabi-yau manifolds,

    S.-T. Yau, “A survey of calabi-yau manifolds,”Surveys in differential geometry 13no. 1, (2008) 277–318

  59. [67]

    A finiteness theorem for elliptic calabi-yau threefolds,

    M. Gross, “A finiteness theorem for elliptic calabi-yau threefolds,”Duke Mathematical Journal74(1993) 271–299. https://api.semanticscholar.org/CorpusID:18131031

  60. [68]

    Boundedness of elliptic Calabi-Yau threefolds,

    S. Filipazzi, C. D. Hacon, and R. Svaldi, “Boundedness of elliptic Calabi-Yau threefolds,”J. Eur. Math. Soc. (JEMS)27no. 9, (2025) 3583–3650. https://doi.org/10.4171/jems/1467

  61. [69]

    Boundedness of elliptic Calabi-Yau varieties with a rational section,

    C. Birkar, G. Di Cerbo, and R. Svaldi, “Boundedness of elliptic Calabi-Yau varieties with a rational section,”J. Differential Geom.128no. 2, (2024) 463–519.https://doi.org/10.4310/jdg/1727712887

  62. [70]

    A Picard rank bound for base surfaces of elliptic Calabi-Yau 3-folds,

    C. Birkar and S.-J. Lee, “A Picard rank bound for base surfaces of elliptic Calabi-Yau 3-folds,”arXiv:2507.06317 [hep-th]

  63. [71]

    Black Holes and Large N Species Solution to the Hierarchy Problem,

    G. Dvali, “Black Holes and Large N Species Solution to the Hierarchy Problem,”Fortsch. Phys.58(2010) 528–536,arXiv:0706.2050 [hep-th]

  64. [72]

    Black Hole Bound on the Number of Species and Quantum Gravity at LHC,

    G. Dvali and M. Redi, “Black Hole Bound on the Number of Species and Quantum Gravity at LHC,”Phys. Rev. D77(2008) 045027,arXiv:0710.4344 [hep-th]

  65. [73]

    Quantum Information and Gravity Cutoff in Theories with Species,

    G. Dvali and C. Gomez, “Quantum Information and Gravity Cutoff in Theories with Species,”Phys. Lett. B674(2009) 303–307,arXiv:0812.1940 [hep-th]

  66. [74]

    Infinite Distances in Field Space and Massless Towers of States,

    T. W. Grimm, E. Palti, and I. Valenzuela, “Infinite Distances in Field Space and Massless Towers of States,”JHEP08(2018) 143,arXiv:1802.08264 [hep-th]. 46

  67. [75]

    IR/UV mixing, towers of species and swampland conjectures,

    A. Castellano, A. Herr´ aez, and L. E. Ib´ a˜ nez, “IR/UV mixing, towers of species and swampland conjectures,”JHEP08(2022) 217,arXiv:2112.10796 [hep-th]

  68. [76]

    Moduli-dependent Species Scale,

    D. van de Heisteeg, C. Vafa, M. Wiesner, and D. H. Wu, “Moduli-dependent Species Scale,”arXiv:2212.06841 [hep-th]

  69. [77]

    Black hole entropy and moduli-dependent species scale,

    N. Cribiori, D. L¨ ust, and G. Staudt, “Black hole entropy and moduli-dependent species scale,”Phys. Lett. B844(2023) 138113,arXiv:2212.10286 [hep-th]

  70. [78]

    The emergence proposal in quantum gravity and the species scale,

    A. Castellano, A. Herr´ aez, and L. E. Ib´ a˜ nez, “The emergence proposal in quantum gravity and the species scale,”JHEP06(2023) 047, arXiv:2212.03908 [hep-th]

  71. [79]

    Species scale in diverse dimensions,

    D. van de Heisteeg, C. Vafa, M. Wiesner, and D. H. Wu, “Species scale in diverse dimensions,”JHEP05(2024) 112,arXiv:2310.07213 [hep-th]

  72. [80]

    The emergence proposal and the emergent string,

    R. Blumenhagen, A. Gligovic, and A. Paraskevopoulou, “The emergence proposal and the emergent string,”JHEP10(2023) 145,arXiv:2305.10490 [hep-th]

  73. [81]

    Perils of towers in the swamp: dark dimensions and the robustness of EFTs,

    C. P. Burgess and F. Quevedo, “Perils of towers in the swamp: dark dimensions and the robustness of EFTs,”JHEP09(2023) 159,arXiv:2304.03902 [hep-th]

  74. [82]

    The Tale of Three Scales: the Planck, the Species, and the Black Hole Scales,

    A. Bedroya, C. Vafa, and D. H. Wu, “The Tale of Three Scales: the Planck, the Species, and the Black Hole Scales,”arXiv:2403.18005 [hep-th]

  75. [83]

    The Double EFT Expansion in Quantum Gravity,

    J. Calder´ on-Infante, A. Castellano, and A. Herr´ aez, “The Double EFT Expansion in Quantum Gravity,”arXiv:2501.14880 [hep-th]

  76. [84]

    EFT & species scale: friends or foes?,

    B. Valeixo Bento and J. F. Melo, “EFT & species scale: friends or foes?,”JHEP 05(2025) 212,arXiv:2501.08230 [hep-th]

  77. [85]

    Fine Tuning, Sequestering, and the Swampland,

    J. J. Heckman and C. Vafa, “Fine Tuning, Sequestering, and the Swampland,” Phys. Lett. B798(2019) 135004,arXiv:1905.06342 [hep-th]

  78. [86]

    Is the number of string vacua finite?

    M. R. Douglas, “Is the number of string vacua finite?” Conference talk available athttp://www.fields.utoronto.ca/audio/05-06/strings/douglas/. Strings 2005, Toronto, July 2005

  79. [87]

    Tame embeddings, volume growth, and complexity of moduli spaces,

    T. W. Grimm, D. Prieto, and M. van Vliet, “Tame embeddings, volume growth, and complexity of moduli spaces,”Phys. Rev. D112no. 10, (2025) 106015, arXiv:2503.15601 [hep-th]

  80. [88]

    Limit sets in o-minimal structures,

    L. van den Dries, M. Edmundo, D. Richardson, and A. Wilkie, “Limit sets in o-minimal structures,”Proceedings of the Real Algebraic and Analytic Geometry Summer School Lisbon 2003: O-Minimal Structures(2005) 172–215. 47

  81. [89]

    New formulations of D = 10 supersymmetry and D8 - O8 domain walls,

    E. Bergshoeff, R. Kallosh, T. Ortin, D. Roest, and A. Van Proeyen, “New formulations of D = 10 supersymmetry and D8 - O8 domain walls,”Class. Quant. Grav.18(2001) 3359–3382,arXiv:hep-th/0103233

  82. [90]

    An SL(2,Z) multiplet of type IIB superstrings,

    J. H. Schwarz, “An SL(2,Z) multiplet of type IIB superstrings,”Phys. Lett. B 360(1995) 13–18,arXiv:hep-th/9508143. [Erratum: Phys.Lett.B 364, 252 (1995)]

  83. [91]

    Some relationships between dualities in string theory,

    P. S. Aspinwall, “Some relationships between dualities in string theory,”Nucl. Phys. B Proc. Suppl.46(1996) 30–38,arXiv:hep-th/9508154

  84. [92]

    Sharpening the Distance Conjecture in diverse dimensions,

    M. Etheredge, B. Heidenreich, S. Kaya, Y. Qiu, and T. Rudelius, “Sharpening the Distance Conjecture in diverse dimensions,”JHEP12(2022) 114, arXiv:2206.04063 [hep-th]

  85. [93]

    Entropy bounds and the species scale distance conjecture,

    J. Calder´ on-Infante, A. Castellano, A. Herr´ aez, and L. E. Ib´ a˜ nez, “Entropy bounds and the species scale distance conjecture,”JHEP01(2024) 039, arXiv:2306.16450 [hep-th]

  86. [94]

    Cecotti,Supersymmetric Field Theories: Geometric Structures and Dualities

    S. Cecotti,Supersymmetric Field Theories: Geometric Structures and Dualities. Cambridge University Press, 1, 2015

  87. [95]

    Tame topology of arithmetic quotients and algebraicity of hodge loci,

    B. Bakker, B. Klingler, and J. Tsimerman, “Tame topology of arithmetic quotients and algebraicity of hodge loci,”Journal of the American Mathematical Society33no. 4, (2020) 917–939

  88. [96]

    Borel,Introduction to arithmetic groups, vol

    A. Borel,Introduction to arithmetic groups, vol. 73 ofUniversity Lecture Series. American Mathematical Society, Providence, RI, 2019. https://doi-org.proxy.library.uu.nl/10.1090/ulect/073. Translated from the 1969 French original [ MR0244260] by Lam Laurent Pham, Edited and wi...

  89. [97]

    Tame Geometry and the String Landscape,

    M. van Vliet, “Tame Geometry and the String Landscape,”Master thesis (Utrecht University)(2022)

  90. [98]

    Tame topology of arithmetic quotients and algebraicity of Hodge loci,

    B. Bakker, B. Klingler, and J. Tsimerman, “Tame topology of arithmetic quotients and algebraicity of Hodge loci,”J. Amer. Math. Soc.33no. 4, (2020) 917–939,arXiv:1810.04801 [math.LO]

  91. [99]

    Are Moduli Vacuum Expectation Values or Parameters?,

    A. Sen, “Are Moduli Vacuum Expectation Values or Parameters?,” arXiv:2502.07883 [hep-th]

  92. [100]

    Decorating Asymptotically Flat Space-Time with the Moduli Space of String Theory,

    A. Sen, “Decorating Asymptotically Flat Space-Time with the Moduli Space of String Theory,”arXiv:2506.13876 [hep-th]

  93. [101]

    Four-dimensionalN=4SYM theory and the swampland,

    H.-C. Kim, H.-C. Tarazi, and C. Vafa, “Four-dimensionalN=4SYM theory and the swampland,”Phys. Rev. D102no. 2, (2020) 026003, arXiv:1912.06144 [hep-th]

  94. [102]

    Old Ideas for New Physicists III: String Theory Parameters are NOT Vacuum Expectation Values,

    T. Banks, “Old Ideas for New Physicists III: String Theory Parameters are NOT Vacuum Expectation Values,”arXiv:2501.17697 [hep-th]. 48

  95. [103]

    Spaces of Quantum Field Theories,

    M. R. Douglas, “Spaces of Quantum Field Theories,”J. Phys. Conf. Ser.462 no. 1, (2013) 012011,arXiv:1005.2779 [hep-th]

  96. [104]

    Towards AdS distances in string theory,

    Y. Li, E. Palti, and N. Petri, “Towards AdS distances in string theory,”JHEP 08(2023) 210,arXiv:2306.02026 [hep-th]

  97. [105]

    Connecting flux vacua through scalar field excursions,

    G. Shiu, F. Tonioni, V. Van Hemelryck, and T. Van Riet, “Connecting flux vacua through scalar field excursions,”Phys. Rev. D109no. 6, (2024) 066017, arXiv:2311.10828 [hep-th]

  98. [106]

    Domain walls and distances in discrete landscapes,

    I. Basile and C. Montella, “Domain walls and distances in discrete landscapes,” JHEP02(2024) 227,arXiv:2309.04519 [hep-th]

  99. [107]

    On measuring distances in the quantum gravity landscape,

    A. Mohseni, M. Montero, C. Vafa, and I. Valenzuela, “On measuring distances in the quantum gravity landscape,”JHEP12(2024) 168,arXiv:2407.02705 [hep-th]

  100. [108]

    A distance conjecture beyond moduli?,

    C. Debusschere, F. Tonioni, and T. Van Riet, “A distance conjecture beyond moduli?,”JHEP03(2025) 140,arXiv:2407.03715 [hep-th]

  101. [109]

    Metrics over multi-parameter AdS vacua,

    E. Palti and N. Petri, “Metrics over multi-parameter AdS vacua,”JHEP07 (2025) 247,arXiv:2504.01316 [hep-th]

  102. [110]

    Counting lattice points and O-minimal structures,

    F. Barroero and M. Widmer, “Counting lattice points and O-minimal structures,”Int. Math. Res. Not. IMRNno. 18, (2014) 4932–4957. https://doi-org.utrechtuniversity.idm.oclc.org/10.1093/imrn/rnt102

  103. [111]

    Finiteness and the Emergence of Dualities,

    M. Delgado, D. van de Heisteeg, S. Raman, E. Torres, C. Vafa, and K. Xu, “Finiteness and the Emergence of Dualities,”arXiv:2412.03640 [hep-th]

  104. [112]

    Yomdin and G

    Y. Yomdin and G. Comte,Tame geometry with application in smooth analysis. Springer, 2004

  105. [113]

    Emergent strings from infinite distance limits,

    S.-J. Lee, W. Lerche, and T. Weigand, “Emergent strings from infinite distance limits,”JHEP02(2022) 190,arXiv:1910.01135 [hep-th]. 49

Pith tools

Reviewed August 3, 2026 · model on record in the stance chip above.