The reviewed record of science sign in
Pith

arxiv: 2302.13042 · v2 · pith:FCGTNEPO · submitted 2023-02-25 · hep-ph · hep-ex· nucl-ex· nucl-th

Effect of time-varying electromagnetic field on Wiedemann-Franz law in a hot hadronic matter

Reviewed by Pithpith:FCGTNEPOopen to challenge →

classification hep-ph hep-exnucl-exnucl-th
keywords fieldmagnetictimetime-varyingwiedemann-franzconstanthadronresonance
0
0 comments X
read the original abstract

We have estimated the electrical and thermal conductivity of a hadron resonance gas for a time-varying magnetic field, which is also compared with constant and zero magnetic field cases. Considering the exponential decay of electromagnetic fields with time, a kinetic theory framework can provide the microscopic expression of electrical and thermal conductivity in terms of relaxation and decay times. In the absence of the magnetic field, only a single time scale appears, and in the finite magnetic field case, their expressions carry two-time scales, relaxation time and cyclotron time period. Estimating the conductivities for HRG matter in three cases -- zero, constant, and time-varying magnetic fields, we have studied the validity of the Wiedemann-Franz law. We noticed that at a high-temperature domain, the ratio saturates at a particular value, which may be considered as Lorenz number of the hadron resonance gas. With respect to the saturation values, the deviation of the Wiedemann-Franz law has been quantified at the low-temperature domain. For the first time, the present work sketches this quantitative deviation of the Wiedemann-Franz law for hadron resonance gas at a constant and a time-varying magnetic field.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Electromagnetic response of a relativistic drifting plasma

    hep-ph 2026-04 unverdicted novelty 4.0

    Time-dependent electric fields in relativistic drifting plasma induce polarization drift that modifies the induced current structure, with quantitative estimates of Hall and polarization contributions provided for the...