Pith. sign in

REVIEW 2 cited by

Alternators For Sequence Modeling

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2405.11848 v2 pith:OT6GVE2T submitted 2024-05-20 stat.ML cs.AIcs.LGcs.NEphysics.ao-phq-bio.NC

classification stat.MLcs.AIcs.LGcs.NEphysics.ao-phq-bio.NC
keywords alternatorsmodelsusedactivityapplieddatadynamicalfeature
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

This paper introduces alternators, a novel family of non-Markovian dynamical models for sequences. An alternator features two neural networks: the observation trajectory network (OTN) and the feature trajectory network (FTN). The OTN and the FTN work in conjunction, alternating between outputting samples in the observation space and some feature space, respectively, over a cycle. The parameters of the OTN and the FTN are not time-dependent and are learned via a minimum cross-entropy criterion over the trajectories. Alternators are versatile. They can be used as dynamical latent-variable generative models or as sequence-to-sequence predictors. Alternators can uncover the latent dynamics underlying complex sequential data, accurately forecast and impute missing data, and sample new trajectories. We showcase the capabilities of alternators in three applications. We first used alternators to model the Lorenz equations, often used to describe chaotic behavior. We then applied alternators to Neuroscience, to map brain activity to physical activity. Finally, we applied alternators to Climate Science, focusing on sea-surface temperature forecasting. In all our experiments, we found alternators are stable to train, fast to sample from, yield high-quality generated samples and latent variables, and often outperform strong baselines such as Mambas, neural ODEs, and diffusion models in the domains we studied.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. The Alpha-Alternator: Dynamic Adaptation To Varying Noise Levels In Sequences Using The Vendi Score For Improved Robustness and Performance

    cs.LG 2025-02 conditional novelty 5.0 of 10

    A Vendi Score-based adaptive gating mechanism, trained with input masking, improves neural decoding and time-series forecasting accuracy relative to several baselines.

  2. Alternators With Noise Models

    cs.LG 2025-05 reject novelty 4.0 of 10

    Alternator++ adds trainable noise-prediction networks and a noise-matching loss to Alternators, but the proposed training target is ill-defined and the reported improvements are mixed.

Pith tools