pith. sign in

arxiv: 2308.07317 · v2 · pith:UIWDAWOYnew · submitted 2023-08-14 · 💻 cs.CL

Platypus: Quick, Cheap, and Powerful Refinement of LLMs

classification 💻 cs.CL
keywords llmsplatypusdataopenachievesdatasetfamilyfine-tuned
0
0 comments X
read the original abstract

We present $\textbf{Platypus}$, a family of fine-tuned and merged Large Language Models (LLMs) that achieves the strongest performance and currently stands at first place in HuggingFace's Open LLM Leaderboard as of the release date of this work. In this work we describe (1) our curated dataset $\textbf{Open-Platypus}$, that is a subset of other open datasets and which $\textit{we release to the public}$ (2) our process of fine-tuning and merging LoRA modules in order to conserve the strong prior of pretrained LLMs, while bringing specific domain knowledge to the surface (3) our efforts in checking for test data leaks and contamination in the training data, which can inform future research. Specifically, the Platypus family achieves strong performance in quantitative LLM metrics across model sizes, topping the global Open LLM leaderboard while using just a fraction of the fine-tuning data and overall compute that are required for other state-of-the-art fine-tuned LLMs. In particular, a 13B Platypus model can be trained on $\textit{a single}$ A100 GPU using 25k questions in 5 hours. This is a testament of the quality of our Open-Platypus dataset, and opens opportunities for more improvements in the field. Project page: https://platypus-llm.github.io

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 11 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. MatryoshkaLoRA: Learning Accurate Hierarchical Low-Rank Representations for LLM Fine-Tuning

    cs.CL 2026-05 unverdicted novelty 7.0

    MatryoshkaLoRA inserts a crafted diagonal matrix P into LoRA to learn accurate nested low-rank adapters that support dynamic rank selection with minimal performance drop.

  2. TRACER: A Semantic-Aware Framework for Fine-Grained Contamination Detection in Code LLMs

    cs.SE 2026-05 unverdicted novelty 6.0

    TRACER presents a semantic-aware framework and the first benchmark for fine-grained code contamination detection across three levels of overlap, reporting F1 scores of 0.91-0.92 and large gains over prior methods.

  3. ToRA: A Tool-Integrated Reasoning Agent for Mathematical Problem Solving

    cs.CL 2023-09 conditional novelty 6.0

    ToRA trains language models on interactive tool-use trajectories with imitation learning and output shaping to integrate reasoning and external tools, yielding 13-19% gains on math datasets and new highs like 44.6% on...

  4. MetaMath: Bootstrap Your Own Mathematical Questions for Large Language Models

    cs.CL 2023-09 conditional novelty 6.0

    Bootstrapping math questions via rewriting creates MetaMathQA; fine-tuning LLaMA-2 on it yields 66.4% on GSM8K for 7B and 82.3% for 70B, beating prior same-size models by large margins.

  5. MAmmoTH: Building Math Generalist Models through Hybrid Instruction Tuning

    cs.CL 2023-09 conditional novelty 6.0

    MAmmoTH models trained via hybrid CoT-PoT instruction tuning on MathInstruct outperform prior open-source LLMs by 16-32% average accuracy on nine math datasets, reaching 33% and 44% on MATH for 7B and 34B scales.

  6. DAG-MoE: From Simple Mixture to Structural Aggregation in Mixture-of-Experts

    cs.AI 2026-05 unverdicted novelty 5.0

    DAG-MoE uses a lightweight module to learn DAG-based structural aggregation of selected experts, expanding combination space and enabling intra-layer multi-step reasoning compared to standard weighted-sum MoE.

  7. ReLoRA: Knowledge-Reusing Adaptation for Fast Rollout of Evolving LLM Services

    cs.LG 2026-05 unverdicted novelty 5.0

    ReLoRA reduces time-to-readiness for LoRA adapters on updated LLMs by up to 8.9x through adaptive Bayesian initialization and scheduled regularization while improving accuracy by up to 4.6%.

  8. Understanding and Improving Noisy Embedding Techniques in Instruction Finetuning

    cs.LG 2026-05 unverdicted novelty 5.0

    SymNoise applies symmetric noise to embeddings during instruction fine-tuning and reports 6.7% higher AlpacaEval scores than NEFTune on LLaMA-2-7B.

  9. Detecting Language Model Attacks with Perplexity

    cs.CL 2023-08 unverdicted novelty 5.0

    Jailbreak prompts with adversarial suffixes have high GPT-2 perplexity, and a LightGBM model on perplexity and length detects most attacks.

  10. Step-Video-T2V Technical Report: The Practice, Challenges, and Future of Video Foundation Model

    cs.CV 2025-02 unverdicted novelty 4.0

    Step-Video-T2V describes a 30B-parameter text-to-video model with custom Video-VAE, 3D DiT, flow matching, and Video-DPO that claims state-of-the-art results on a new internal benchmark.

  11. Siren's Song in the AI Ocean: A Survey on Hallucination in Large Language Models

    cs.CL 2023-09 unverdicted novelty 4.0

    A literature survey that taxonomizes hallucination phenomena in LLMs, reviews evaluation benchmarks, and analyzes approaches for their detection, explanation, and mitigation.