Pith. sign in

REVIEW

A Comprehensive Analysis of Information Leakage in Deep Transfer Learning

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2009.01989 v1 pith:VBSV5DYX submitted 2020-09-04 cs.CL cs.LG

A Comprehensive Analysis of Information Leakage in Deep Transfer Learning

classification cs.CL cs.LG
keywords learningtransferdeepleakageprivacypotentialanalysisdatasets
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Transfer learning is widely used for transferring knowledge from a source domain to the target domain where the labeled data is scarce. Recently, deep transfer learning has achieved remarkable progress in various applications. However, the source and target datasets usually belong to two different organizations in many real-world scenarios, potential privacy issues in deep transfer learning are posed. In this study, to thoroughly analyze the potential privacy leakage in deep transfer learning, we first divide previous methods into three categories. Based on that, we demonstrate specific threats that lead to unintentional privacy leakage in each category. Additionally, we also provide some solutions to prevent these threats. To the best of our knowledge, our study is the first to provide a thorough analysis of the information leakage issues in deep transfer learning methods and provide potential solutions to the issue. Extensive experiments on two public datasets and an industry dataset are conducted to show the privacy leakage under different deep transfer learning settings and defense solution effectiveness.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.