Pith. sign in

REVIEW 4 major objections 5 minor 41 references

Constraining f(R,T) Gravity From The Dark Energy Density Parameter $\Omega_{\Lambda}$

T0 review · 4 major / 5 minor · reviewed 2026-08-14 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read The f(R,T) model parameter λ is bounded below by −1.9×10⁻⁸ using the observed dark-energy density.

desk verdict The reported λ bound is a mirage: Eq. (11) fails its own GR limit by a factor 8π, and the quoted constraint is just the arithmetic that cancels the spurious constant 24. read the letter →

arxiv 1908.06759 v4 pith:XO6I77UB submitted 2019-08-16 gr-qc hep-th

Snehasish Bhattacharjee , P.K. Sahoo This is my paper · ORCID
classification gr-qchep-th PACS 04.50.Kd98.80.Es
keywords f(RT)gravitydarkenergydensityparametercosmologicalconstantmodifiedFriedmannequationcriticalmodelconstraintscosmicmicrowavebackgroundcosmology
topics Dark Energy
open problems Dark Energy
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper tries to show that the most widely used f(R,T) gravity model, $f(R,T)=R+2\lambda T$, can be constrained by the measured dark-energy density parameter $\Omega_\Lambda$. By equating the model's modified Friedmann equation with the standard cosmological-constant Friedmann equation and replacing the matter density with the critical density, the authors derive $\Omega_\Lambda=(1/(8\pi G))(2\lambda+192\pi G)$. Inserting the 2018 cosmic-microwave-background value $\Omega_\Lambda=0.6889\pm0.0056$ gives the lower bound $\lambda\gtrsim -1.9\times10^{-8}$. If correct, the model is observationally almost indistinguishable from general relativity at present-day densities, and the method offers a template for constraining other $f(R,T)$ functional forms.

What carries the argument

The carrying object is the derived relation between the cosmological constant and the critical density, $\Omega_\Lambda=(1/(8\pi G))(2\lambda+192\pi G)$ (Eq. 20). It is obtained by substituting $\omega=-1$ into the modified Friedmann equation $H^2=(8\pi G/3)(8\pi+3\lambda)\rho-(2/3)\lambda\omega\rho$, dropping the $8\pi G$ term against $2/3$, equating the result with the standard general-relativity Friedmann equation that includes $\Lambda$, and replacing the density $\rho$ with the critical density $\rho_{\mathrm{cr}}$ using $\Omega_0\simeq1$. This identity converts a cosmological measurement into a constraint on the model parameter $\lambda$.

What would settle it

Substitute $\lambda=0$ into the paper's Eq. (20): it predicts $\Omega_\Lambda=24$, while the measured value is $0.6889\pm0.0056$; checking whether the modified Friedmann equation actually reduces to $H^2=(8\pi G/3)\rho$ at $\lambda=0$ settles whether the bound is physical.

Watch

Extended reading notes

Core claim

The paper's central claim is that the parameter $\lambda$ in $f(R,T)=R+2\lambda T$ is bounded below by $\lambda\gtrsim -1.9\times10^{-8}$, and that this bound follows from the observed dark-energy density parameter alone. The derivation starts from the modified Friedmann equation, sets the equation-of-state parameter to $\omega=-1$, neglects the term $8\pi G$ in comparison with $2/3$, and equates the resulting $H^2$ with the standard cosmological-constant Friedmann equation. Substituting the matter density with the critical density $\rho_{\mathrm{cr}}=3H_0^2/(8\pi G)$ on the strength of $\Omega_0\simeq1$ then yields $\Omega_\Lambda=(1/(8\pi G))(2\lambda+192\pi G)$. The measured $\Omega_\Lambda=0.6889\pm0.0056$ fixes the lower bound, and the paper concludes that $\lambda$ is cosmologically trivial and that the model is consistent with observation.

Load-bearing premise

The whole derivation rests on the modified Friedmann equation $H^2=(8\pi G/3)(8\pi+3\lambda)\rho-(2/3)\lambda\omega\rho$ being correct, even though its $\lambda=0$ limit gives $H^2=(64\pi^2G/3)\rho$ rather than the standard general-relativity result $H^2=(8\pi G/3)\rho$.

Editorial extensions

If this is right

  • If the bound holds, $f(R,T)=R+2\lambda T$ with $\lambda\gtrsim -1.9\times10^{-8}$ is observationally indistinguishable from general relativity at present-day densities.
  • The dark-energy density parameter fixes the model parameter up to a lower bound, so the model does not require an independent cosmological constant.
  • The same $\Lambda$–$\rho_{\mathrm{cr}}$ comparison can be applied to constrain other $f(R,T)$ functional forms.
  • Values of $\lambda$ below $-1.9\times10^{-8}$ would push the predicted $\Omega_\Lambda$ outside the observed range and are disfavored by this test.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • In my reading, the number is only as reliable as the modified Friedmann equation it starts from: its $\lambda=0$ limit gives $H^2=(64\pi^2G/3)\rho$, not the general-relativity result, so the constant 24 in Eq. (20) may be an artifact of the derivation rather than a physical prediction.
  • A corrected re-derivation could turn the constraint into a near-identity or remove it; the lasting value is the general scheme of comparing modified-gravity parameters with the measured $\Omega_\Lambda$.
  • Applying the same comparison to $f(R,T)$ forms with nonzero $f_{,R}$ or $f_{,RR}$ terms would keep the extra derivative contributions in the field equations and make the test genuinely dynamical.
  • The paper's conclusion that $\lambda$ is trivial is stronger than the derivation supports, since the same equation predicts $\Omega_\Lambda=24$ at $\lambda=0$; the model needs the $\lambda$ term to cancel a large baseline.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. The paper proposes a constraint on the parameter λ in the f(R,T) gravity model f(R,T)=R+2λT by relating the modified Friedmann equation to the standard Friedmann equation with a cosmological constant. Using the measured dark-energy density parameter Ω_Λ=0.6889±0.0056 from Planck and the definition of critical density, the authors derive Eq. (20), Ω_Λ=1/(8πG)(2λ+192πG), from which they obtain the lower bound λ≳−1.9×10⁻⁸. They conclude that λ is negligible and that the model is observationally indistinguishable from general relativity at present-epoch densities.

Significance. If the central relation (20) were valid, the paper would provide a simple, falsifiable constraint on a widely used modified-gravity model, and the reported lower bound would be a useful guide for cosmological tests. The paper does not provide machine-checked proofs or numerical code, and it contains no independent check of the central relation. Unfortunately, the derivation fails an elementary internal-consistency test: the modified Friedmann equation does not reduce to the general-relativity equation in the λ→0 limit, and the resulting constant 24 in Eq. (20) is an artifact of that failure. The quoted bound is therefore not a property of f(R,T) gravity but a consequence of an inconsistent seed equation.

major comments (4)
  1. [Section II, Eq. (11) and Eq. (14)] The modified Friedmann equation fails the paper's own general-relativity limit. Setting λ=0 in Eq. (11) gives H²=(64π²G/3)ρ, which is a factor 8π larger than the standard GR equation H²=(8πG/3)ρ quoted as Eq. (14). The paper states after Eq. (3) that the field equations reduce to standard GR when f(R,T)≡R, but Eq. (11) does not satisfy this requirement. This spurious factor propagates through Eqs. (13), (15), (16), and (20), where it appears as the constant 24. The central claim λ≳−1.9×10⁻⁸ is therefore not supported.
  2. [Eq. (11), and between Eqs. (12) and (13)] The derivation mixes dimensionless numbers with dimensional couplings. In Eq. (11), the factor (8π+3λ) adds a dimensionless constant to a coupling λ that has dimensions of length squared in natural units. Likewise, the statement '8πG ≪ 2/3' compares a quantity with dimensions of length squared (8πG) with a pure number (2/3), so the approximation is not dimensionally meaningful. Consequently, the simplified Eq. (13) is not a valid limit of Eq. (12), and the subsequent equating of Hubble parameters is not justified.
  3. [Section III, Eq. (20)] The result in the general-relativity limit is unphysical and was not sanity-checked. Setting λ=0 in Eq. (20) gives Ω_Λ=24, which contradicts both the standard critical-density relation used in Eq. (19) and the measured value Ω_Λ=0.6889±0.0056 cited in the text. Since Eq. (20) is then inverted to solve for λ, the reported bound is fixed by the erroneous constant 24 rather than by any physical feature of the f(R,T) model. The paper never evaluates Eq. (20) at λ=0, which is the minimal consistency test that would have exposed the problem.
  4. [Section III, Eqs. (16)-(20)] The derivation is largely an algebraic rearrangement of the input data. Equation (17) inserts the observed Ω_Λ, Eq. (19) inserts the standard critical density, and, after substitution, Eq. (20) returns λ by solving a linear relation. The output is therefore predetermined by the input once Eq. (20) is accepted; no independent prediction or falsifiable test is provided. Moreover, equating Eq. (13) with Eq. (14) assumes that the matter density ρ appearing in the modified Friedmann equation and the density appearing in the GR Friedmann equation are the same physical quantity, an identification that is not established in the paper.
minor comments (5)
  1. [Abstract] The phrase 'f(R+2λT)' is inconsistent with the model defined in Eq. (10), f(R,T)=R+2λT; the abstract should state the model correctly.
  2. [Section III, observational constraint] No uncertainty is quoted for the derived bound λ≳−1.9×10⁻⁸; the paper should propagate the quoted uncertainty ±0.0056 in Ω_Λ through Eq. (20).
  3. [Equations (8) and (9)] These equations contain typesetting errors (for example, 'Π μν f1,R(R,T)' and the unbalanced parentheses) that make them difficult to verify; they should be carefully rewritten.
  4. [Notation] The symbol 'greaterorsimilar' should be typeset as \gtrsim, and the equation numbers should be referenced consistently after Eq. (20).
  5. [References] Some references cite arXiv preprints or incomplete metadata instead of the final published versions; this should be corrected before resubmission.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: the paper constrains a free parameter from an external observable, which is ordinary parameter estimation rather than a circular prediction, despite serious internal consistency errors.

full rationale

The paper's derivation chain is: adopt f(R,T)=R+2λT, obtain the modified Friedmann equation (Eq. 11), substitute ω=-1 and approximate to Eq. (13), equate with the GR+Λ Friedmann equation (Eq. 14) to obtain Λ in terms of ρ (Eq. 16), then use the standard definitions of Λ and the critical density (Eqs. 17 and 19) to obtain Eq. (20), Ω_Λ = (2λ+192πG)/(8πG). The measured Planck value Ω_Λ=0.6889 is then inserted to solve for λ, yielding the quoted lower bound. This is a one-parameter constraint from a single external observable, not a prediction of a closely related quantity from a fitted parameter, and there is no self-definitional loop: λ is not defined in terms of Ω_Λ, but solved for from a theoretical relation. The derivation is self-contained in the sense that every step is stated in the paper and no load-bearing conclusion relies on self-citations. Therefore no circularity of the enumerated kinds is present. A separate, non-circular concern is that Eq. (11) fails the paper's own GR limit by a factor 8π when λ=0, and the approximation 8πG ≪ 2/3 is dimensionally invalid; these are correctness issues that undermine the numerical bound, but they do not constitute circularity.

Assumptions & free parameters 1 free parameters · 5 assumptions · 0 invented entities

The apparent constraint is produced by inserting the measured Ω_Λ (Eq. 17) and the GR definition of ρ_cr (Eq. 19) into an equation (Eq. 13) that already carries a factor-8π error relative to GR; λ is then solved as λ = 4πG(Ω_Λ − 24). One free parameter (λ) is effectively fitted to the data, and the listed axioms are the model choices and substitutions the paper makes, one of which (Eq. 11 reducing to GR when λ = 0) is violated by the paper's own equations.

free parameters (1)
  • λ (f(R,T) model parameter) = ≈ −1.9×10⁻⁸ (claimed lower bound; effectively solved from Ω_Λ = 0.6889)
    λ is the model parameter of f(R,T) = R + 2λT. Although presented as being constrained, Eq. (20) is solved for λ once Ω_Λ is inserted, with λ = 4πG(Ω_Λ − 24); the 'bound' is the value needed for the paper's field equation to reproduce the input Ω_Λ.
assumptions (5)
  • domain assumption Eq. (11), H² = (8πG/3)(8π + 3λ)ρ − (2/3)λωρ, is the correct Friedmann equation for f(R,T) = R + 2λT and reduces to GR when λ = 0.
    The entire constraint chain depends on Eq. (11). The λ → 0 limit of Eq. (11) is H² = (64π²G/3)ρ, a factor 8π larger than GR, so this assumption is violated by the paper's own equation. See Section II, Eq. (11) and Section III, Eqs. (12)-(20).
  • domain assumption The f(R,T) expansion equation (Eq. 13) and the GR + Λ expansion equation (Eq. 14) describe the same universe and can be equated and solved for λ.
    Matching modified gravity to ΛCDM is legitimate as a modeling choice, but here it is applied to an equation that already contains the GR-limit error; the paper simply cancels H² on both sides and solves for λ. Section III.
  • ad hoc to paper At the present epoch, the density ρ inside the modified Friedmann equation can be replaced by the critical density ρ_cr.
    The paper justifies this with Ω₀ ≈ 1, but ρ is the dynamical density sourcing H² in the f(R,T) model while ρ_cr is defined by GR's 3H₀²/(8πG). Substituting one for the other pre-imposes the ΛCDM normalization and feeds the measured Ω_Λ into the bound. Section III, before Eq. (18).
  • ad hoc to paper The term 8πG can be neglected relative to 2/3 because '8πG ≪ 2/3'.
    Dimensionally inconsistent comparison: 8πG carries units while 2/3 is dimensionless. The step is not needed for the final form and conceals the units problem. Section III, between Eqs. (12) and (13).
  • domain assumption The equation of state parameter is ω ≈ −1 at the present epoch.
    Standard observational input (ref. [6]); it sets T = 4ρ and simplifies Eq. (11) into Eq. (12). Sections II and III.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Constraining f(R,T) Gravity From The Dark Energy Density Parameter $\Omega_{\Lambda}$." pith.science (2026). https://pith.science/paper/XO6I77UB

@misc{pith2026190806759,
  author       = {Pith},
  title        = {Pith review of: Constraining f(R,T) Gravity From The Dark Energy Density Parameter $\Omega_\Lambda$},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/XO6I77UB}},
  note         = {Machine review of arXiv:1908.06759}
}
abstract

$f(R,T)$ gravity is a widely used extended theory of gravity introduced in \cite{9} which is a straightforward generalization of $f(R)$ gravity. The action in this extended theory of gravity incorporates well motivated functional forms of the Ricci scalar $R$ and trace of energy momentum tensor $T$. The present manuscript aims at constraining the most widely used $f(R,T)$ gravity model of the form $f(R+2\lambda T)$ to understand its coherency and applicability in cosmology. We communicate here a novel method to find an lower bound on the model parameter $\lambda \gtrsim -1.9 \times 10^{-8}$ through the equation relating the cosmological constant ($\Lambda$) and the critical density of the universe ($\rho_{cr}$).

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

41 extracted references · 35 canonical work pages

  1. [1]

    J. R. Adler, et al., American Journal of Physics, 63, 620 (1995)

    work page 1995

  2. [2]

    P Hobson, G

    M. P Hobson, G. P Efstathiou & A. N Lasenby (2006). General Relativity: An introduction for physicists (Reprinted.). Cam- bridge University Press. p. 187

    work page 2006

  3. [3]

    Hubble, Proc

    E. Hubble, Proc. Nat. Acad. Sci. U.S.A., 15, 168 (1929)

    work page 1929

  4. [4]

    A. G. Reiss et al., Astron. J. 116, 1009 (1998)

    work page 1998

  5. [5]

    Perlmutter et al., Astrophys

    S. Perlmutter et al., Astrophys. J. 517, 565 (1999)

    1999

  6. [6]

    Rebolo et al., MNRAS, 353, 747 (2004)

    R. Rebolo et al., MNRAS, 353, 747 (2004)

    work page 2004

  7. [7]

    E. J. Copeland, M. Sami, S. Tsujikawa, Int. J. Mod. Phys. D , 15, 1753 (2006)

    2006

  8. [8]

    H. A. Buchdahl, MNRAS, 150, 1 (1970)

    1970

Show all 41 references
  1. [9]

    Femaro, F

    R. Femaro, F. Fiorini, Phys. Rev . D, 75, 084031 (2007)

    2007

  2. [10]

    Harko et al., Phys

    T. Harko et al., Phys. Rev . D, 84, 024020 (2011)

    2011

  3. [11]

    Nojiri, et al., Phys

    S. Nojiri, et al., Phys. Suppl., 172, 81, (2008)

    2008

  4. [12]

    P . K. Sahoo, S. K. Tripathy , P . Sahoo, Mod. Phys. Lett. A., 33, 1850193 (2018)

    2018

  5. [13]

    M. J. S. Houndjo, Int. J. Mod. Phys. D, 21, 1250003 (2012)

    2012

  6. [14]

    Singh & C

    V . Singh & C. P . Singh, Astrophys. Space Sci, 356, 153 (2015)

    2015

  7. [15]

    V . U. M. Rao & D. C. Papa Rao, Astrophys. Space Sci, 357, 1 (2015)

    2015

  8. [16]

    M. F. Shamir, Int. J. Theor. Phys, 54, 1304 (2015)

    2015

  9. [17]

    Ahmed & A

    N. Ahmed & A. Pradhan, Int. J. Theor. Phys, 53, 289 (2014)

    2014

  10. [18]

    P . K. Sahoo & M. Sivakumar, Astrophys. Space Sci, 357, 1 (2015)

    2015

  11. [19]

    Friedman, ”Uber die Krummung des Raumes”

    A. Friedman, ”Uber die Krummung des Raumes”. Z. Phys. (i n German). 10 (1): 377-386, (1922)

    1922

  12. [20]

    Rowlands, arXiv:1306.4620

    P . Rowlands, arXiv:1306.4620

    arXiv

  13. [21]

    P . H. R. S. Moreas, Int. J. Theor. Phys, 55, 1307 (2016)

    2016

  14. [22]

    S. K. Srivastava, General Relativity and Cosmology , PH I, (2008)

    2008

  15. [23]

    T. P . Cheng, Relativity , Gravitation and Cosmology: A B asic Introduction, Oxford University Press, New York, Seco nd Edi- tion, (2010)

    2010

  16. [24]

    Planck Collaboration, 2018; arXiv:1807.06209

    2018 arXiv

  17. [25]

    Einstein, A. (1917). ”Kosmologische Betrachtungen zu r allgemeinen Relativitatstheorie”. Sitzungsberichte de r Koniglich Preubischen Akademie der Wissenschaften. Berlin, DE. part 1: 142-152. Bibcode:1917SP AW.......142E

    1917

  18. [26]

    Zaregonbadi, et al., Phys

    R. Zaregonbadi, et al., Phys. Rev . D 94, 084052 (2016)

    2016

  19. [27]

    Sun and Y .-C

    G. Sun and Y .-C. Huang, Int. J. Mod. Phys. D, 25, 1650038 (2016)

    2016

  20. [28]

    Rocha et al

    F. Rocha et al. arXiv:1911.08894 (2019)

    2019 arXiv

  21. [29]

    dos Santos, G.A

    S.I. dos Santos, G.A. Carvalho, P .H.R.S. Moraes, C.H. L enzi, M. Malheiro, Eur. Phys. J. Plus, 134, 398 (2019); P .H.R.S. Moraes, J.D.V . Arbanil, M. Malheiro, J. Cosm. Astrop. Phys. 06, 005 (2016)

    2019

  22. [30]

    Moraes, P .K

    P .H.R.S. Moraes, P .K. Sahoo, Eur. Phys. J. C 79, 677 (2019); E. Elizalde and M. Khurshudyan, Phys. Rev . D, 99, 024051 (2019); P .H.R.S. Moraes, W. de Paula, R.A.C. Correa, Int. J. Mod. Phys. D, 28, 1950098 (2019); E. Elizalde, M. Khurshudyan, Phys. Rev . D, 98, 123525 (2018...

    2019

  23. [31]

    Sharif, A

    M. Sharif, A. Siddiqa, Gen. Relativ . Gravit, 51, 74 (2019); M.E.S. Alves, P .H.R.S. Moraes, J.C.N. de Araujo, M. Malheiro, Phys. Rev . D,94, 024032 (2016); MZ Bhatti, Z Yousaf, M Yousaf, Phys. Dark. Un iverse. 28, 100501 (2020)

    2019

  24. [32]

    Sahoo, S

    P .K. Sahoo, S. Bhattacharjee, Int. J. Theor. Phys, DOI: 10.1007/s10773-020-04414-3 (2020) [arXiv: 1907.13460]

    2020 arXiv

  25. [33]

    Bhattacharjee, P

    S. Bhattacharjee, P . K. Sahoo, Eur. Phys. J. C. 80, 289 (2020) [arXiv: 2002.11483]

    2020 arXiv

  26. [34]

    Sahoo, S

    P . Sahoo, S. Bhattacharjee, S.K. Tripathy , P .K. Sahoo, Mod. Phys. Lett. A, DOI: 10.1142/S0217732320500959 (2020) [arXiv: 1907.08682]

    2020 arXiv

  27. [35]

    Bhattacharjee, P

    S. Bhattacharjee, P . K. Sahoo, Phys. Dark. Universe. 28, 100537 (2020) [arXiv: 2003.14211]

    2020 arXiv

  28. [36]

    Bhattacharjee, P

    S. Bhattacharjee, P . K. Sahoo, Eur. Phys. J. Plus, 135, 86 (2020) [ arXiv:2001.06569]

    2020 arXiv

  29. [37]

    Bhattacharjee, [ arXiv:2004.06884]

    S. Bhattacharjee, [ arXiv:2004.06884]

    2004 arXiv

  30. [38]

    Bhattacharjee, P

    S. Bhattacharjee, P . K. Sahoo, Eur. Phys. J. Plus, 135, 350 (2020)

    2020

  31. [39]

    Bhatti, Z

    M.Z. Bhatti, Z. Yousaf, M. Ilyas, J. Astrophys. Astr. 39, 69 (2018)

    2018

  32. [40]

    Yousaf, Phys

    Z. Yousaf, Phys. Dark Universe 28, 100509 (2020)

    2020

  33. [41]

    Yousaf, K

    Z. Yousaf, K. Bamba, M.Z. Bhatti, Phys. Rev . D 93, 124048 (2016)

    2016

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.