Pith. sign in

REVIEW 8 cited by

Subleading Weingartens

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2107.10252 v2 pith:UIK4N43O submitted 2021-07-21 hep-th cond-mat.str-el

classification hep-thcond-mat.str-el
keywords subleadingbrownianfindgravitytermsamplifiedanalogousbulk
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Haar integrals over the unitary group contain subleading terms that are needed for unitarity. We study analogous effects in the time evolution operators of JT gravity and Brownian SYK. In JT gravity with bulk matter we find an explanation for the first subleading terms, and in Brownian SYK we find configurations that can explain the full series. An important role is played by slightly off-shell modes that are exponentially amplified by chaos.

Discussion (0). Sign in to comment.

Forward citations

Cited by 8 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. All-order fluctuating hydrodynamics of the SYK lattice

    hep-th 2026-04 conditional novelty 8.0 of 10

    Derives the all-order fluctuating hydrodynamics effective action and transport coefficients for the SYK lattice from its microscopic pseudo-Goldstone boson action.

  2. A de Sitter Anti-Scrambling Algebra

    hep-th 2026-07 conditional novelty 7.0 of 10

    In a toy model of de Sitter quantum gravity, shockwave time advances break the KMS condition and prevent the Hartle-Hawking state from being a trace on the observer's crossed-product algebra.

  3. Enhancing Many-Body Chaos via Entropy Injection from Environment

    quant-ph 2026-06 unverdicted novelty 7.0 of 10

    Entropy injection from an environment enlarges the effective Hilbert space and enhances many-body chaos, demonstrated via analytical computation of relaxation and Lyapunov exponent in a solvable complex Brownian SYK model.

  4. The algebraic structure of gravitational scrambling

    hep-th 2025-08 conditional novelty 7.0 of 10

    The paper builds an operator algebra, the modular-twisted product, that captures black hole scrambling exactly at the scrambling time and reduces to previously known free and tensor product algebras in the appropriate limits.

  5. Negative shocks versus static patch holography

    hep-th 2026-07 conditional novelty 6.0 of 10

    Out-of-time-order correlators along a de Sitter observer worldline, computed with the shockwave eikonal formalism including recoil and backreaction, violate the cyclicity and positivity required of a trace, falsifying...

  6. Entanglement spreading and emergent locality in Brownian SYK chains

    hep-th 2025-07 unverdicted novelty 6.0 of 10

    In a Brownian SYK chain at strong coupling, information from an injected qudit spreads inside a sharp light-cone at the butterfly velocity because the governing dynamics reduce to FKPP domain walls.

  7. Fiducial observers and the thermal atmosphere in the black hole quantum throat

    hep-th 2025-07 unverdicted novelty 6.0 of 10

    A semiclassical construction of fiducial observers in JT gravity, fixed by conformal isometry flow, is extended to the quantum regime to compute wormhole contributions yielding finite thermal entropy and a quantum des...

  8. Post-Selection Probability and Fidelity of Bidirectional Teleportation

    quant-ph 2026-06 unverdicted novelty 4.0 of 10

    Post-selection probability and fidelity of bidirectional teleportation are expressed via the Loschmidt echo, revealing initial-state dependence of fidelity and stability of probability in integrable models.

Pith tools