Pith. sign in

REVIEW 25 cited by

DeepSpeed-Chat: Easy, Fast and Affordable RLHF Training of ChatGPT-like Models at All Scales

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2308.01320 v1 pith:3EHXXDP4 submitted 2023-08-02 cs.LG cs.AIcs.CL

classification cs.LGcs.AIcs.CL
keywords trainingmodelsdeepspeed-chatrlhfchatgpt-likepipelinesystemaccessible
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

ChatGPT-like models have revolutionized various applications in artificial intelligence, from summarization and coding to translation, matching or even surpassing human performance. However, the current landscape lacks an accessible, efficient, and cost-effective end-to-end RLHF (Reinforcement Learning with Human Feedback) training pipeline for these powerful models, particularly when training at the scale of billions of parameters. This paper introduces DeepSpeed-Chat, a novel system that democratizes RLHF training, making it accessible to the AI community. DeepSpeed-Chat offers three key capabilities: an easy-to-use training and inference experience for ChatGPT-like models, a DeepSpeed-RLHF pipeline that replicates the training pipeline from InstructGPT, and a robust DeepSpeed-RLHF system that combines various optimizations for training and inference in a unified way. The system delivers unparalleled efficiency and scalability, enabling training of models with hundreds of billions of parameters in record time and at a fraction of the cost. With this development, DeepSpeed-Chat paves the way for broader access to advanced RLHF training, even for data scientists with limited resources, thereby fostering innovation and further development in the field of AI.

Discussion (0). Sign in to comment.

Forward citations

Cited by 25 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Bidirectional Resource Scheduling for Disaggregated and Asynchronous RL Post-Training

    cs.DC 2026-07 accept novelty 7.0 of 10

    BiDiRL raises disaggregated asynchronous LLM RL throughput up to 1.94× by hot-switching idle GPUs between rollout and training under a model-guided bidirectional scheduler.

  2. HetRL: Efficient Reinforcement Learning for LLMs in Heterogeneous Environments

    cs.DC 2025-12 unverdicted novelty 7.0 of 10

    HetRL delivers up to 9.17x higher throughput for LLM RL training on heterogeneous GPUs by using hybrid and ILP-based schedulers to solve a joint optimization problem over computation and data dependencies.

  3. Spend Your Rollouts Where It Counts: Rollout Allocation for Group-Based RL Post-Training

    cs.LG 2026-05 unverdicted novelty 6.0 of 10

    Pilot-Commit estimates per-prompt informativeness via a pilot stage and skips low-variance prompts, matching baseline accuracy with up to 4.0x fewer cumulative rollouts than DAPO on math reasoning tasks.

  4. ROSE: Rollout On Serving GPUs via Cooperative Elasticity for Agentic RL

    cs.DC 2026-05 unverdicted novelty 6.0 of 10

    ROSE delivers 1.2-3.3x higher end-to-end throughput for agentic RL by safely co-using underutilized serving GPUs for rollouts while meeting serving SLOs.

  5. ROSE: Rollout On Serving GPUs via Cooperative Elasticity for Agentic RL

    cs.DC 2026-05 unverdicted novelty 6.0 of 10

    ROSE is a system for cooperative elasticity that co-locates serving and rollout models on shared GPUs, delivering 1.3-3.3x higher end-to-end throughput than fixed-resource baselines while preserving serving SLOs.

  6. DORA: A Scalable Asynchronous Reinforcement Learning System for Language Model Training

    cs.LG 2026-04 unverdicted novelty 6.0 of 10

    DORA's multi-version streaming rollout enables 2-3x higher throughput in asynchronous RL for LLMs while preserving convergence by maintaining policy consistency, data integrity, and bounded staleness.

  7. JigsawRL: Assembling RL Pipelines for Efficient LLM Post-Training

    cs.LG 2026-04 unverdicted novelty 6.0 of 10

    JigsawRL achieves up to 1.85x higher throughput in LLM RL pipelines via pipeline multiplexing, sub-stage graphs, and look-ahead scheduling compared to prior systems.

  8. TENT: A Declarative Slice Spraying Engine for Performant and Resilient Data Movement in Disaggregated LLM Serving

    cs.DC 2026-04 conditional novelty 6.0 of 10

    A telemetry-driven slice-spraying transfer engine with late-binding path selection improves LLM serving throughput and self-heals from link failures in tens of milliseconds.

  9. FP8-RL: A Practical and Stable Low-Precision Stack for LLM Reinforcement Learning

    cs.LG 2026-01 unverdicted novelty 6.0 of 10

    FP8-RL delivers up to 44% faster rollouts in LLM RL by using blockwise FP8 quantization, KV-cache recalibration, and importance-sampling corrections while keeping learning behavior close to BF16 baselines.

  10. Periodic Asynchrony: An On-Policy Approach for Accelerating LLM Reinforcement Learning

    cs.LG 2025-11 unverdicted novelty 6.0 of 10

    A periodically asynchronous on-policy RL system for LLM post-training achieves up to 3x throughput gains by separating inference and training with periodic policy synchronization and a tri-model architecture.

  11. Seer: Online Context Learning for Fast Synchronous LLM Reinforcement Learning

    cs.DC 2025-11 unverdicted novelty 6.0 of 10

    Seer improves synchronous LLM RL rollout throughput by up to 2.04x and reduces long-tail latency by 72-94% via divided rollout, context-aware scheduling, and adaptive grouped speculative decoding based on prompt simil...

  12. HybridFlow: A Flexible and Efficient RLHF Framework

    cs.LG 2024-09 unverdicted novelty 6.0 of 10

    HybridFlow combines single- and multi-controller paradigms with a 3D-HybridEngine to deliver 1.53x to 20.57x higher throughput for various RLHF algorithms compared to prior systems.

  13. OpenRLHF: An Easy-to-use, Scalable and High-performance RLHF Framework

    cs.AI 2024-05 unverdicted novelty 6.0 of 10

    OpenRLHF is a new open-source RLHF framework reporting 1.22x to 1.68x speedups and fewer lines of code than prior systems.

  14. JoyNexus: Service-Oriented Multi-Tenant Post-Training for VLA Models

    cs.DC 2026-07 conditional novelty 5.0 of 10

    A service-oriented multi-tenant architecture with schema-compatible group batching reduces aggregate GPU time for VLA post-training by about 28% in simulation.

  15. PlexRL: Cluster-Level Orchestration of Serviceized LLM Execution for RLVR

    cs.DC 2026-05 unverdicted novelty 5.0 of 10

    PlexRL multiplexes unified LLM services across RLVR jobs at the cluster level to exploit anti-correlated idle times and reduce GPU-hour costs by up to 37.58% with minimal per-job overhead.

  16. Echo: Decoupling Inference and Training for Large-Scale RL Alignment on Heterogeneous Swarms

    cs.LG 2025-08 conditional novelty 5.0 of 10

    A decoupled RL training system matches a co-located baseline's learning curves while generating trajectories on heterogeneous edge hardware, but only the sequential protocol is evaluated.

  17. Towards Hallucination-Free Music: A Reinforcement Learning Preference Optimization Framework for Reliable Song Generation

    cs.SD 2025-08 conditional novelty 5.0 of 10

    PER-based preference optimization (DPO, PPO, GRPO) reduces lyric-to-song hallucination in an audio language model, with the largest gains from DPO plus reject sampling.

  18. Libra: Efficient Resource Management for Agentic RL Post-Training

    cs.LG 2026-06 unverdicted novelty 4.0 of 10

    Libra optimizes GPU allocation across rollout and training in agentic RL via an elastic hybrid pool and C-MLFQ scheduler based on tool-return causal signals, claiming up to 3.0x throughput and 2.5x faster reward conve...

  19. Safactory: A Scalable Agentic Infrastructure for Training Trustworthy Autonomous Intelligence

    cs.AI 2026-05 unverdicted novelty 4.0 of 10

    Safactory integrates three platforms for simulation, data management, and agent evolution to create a unified pipeline for training trustworthy autonomous AI.

  20. Safactory: A Scalable Agentic Infrastructure for Training Trustworthy Autonomous Intelligence

    cs.AI 2026-05 unverdicted novelty 3.0 of 10

    Safactory combines parallel simulation, trustworthy data management, and asynchronous evolution platforms into a single pipeline claimed to be the first unified framework for trustworthy autonomous agents.

  21. Reinforcement Learning Meets Large Language Models: A Survey of Advancements and Applications Across the LLM Lifecycle

    cs.CL 2025-09 conditional novelty 3.0 of 10

    A survey that maps reinforcement learning methods, datasets, benchmarks, and open-source tools across the full training lifecycle of large language models, focusing on verifiable-reward reasoning.

  22. A Survey of Large Language Models

    cs.CL 2023-03 accept novelty 3.0 of 10

    This survey reviews the background, key techniques, and evaluation methods for large language models, emphasizing emergent abilities that appear at large scales.

  23. The Hitchhiker's Guide to Agentic AI: From Foundations to Systems

    cs.AI 2026-06 unverdicted novelty 2.0 of 10

    A comprehensive reference book organizing existing techniques for agentic AI systems across LLM substrate, reasoning, agent design patterns, inter-agent coordination, and production deployment.

  24. Reinforcement Learning from Human Feedback: A Statistical Perspective

    stat.ML 2026-04 accept novelty 2.0 of 10

    A statistical survey of RLHF for LLM alignment that connects preference learning and policy optimization to models like Bradley-Terry-Luce while reviewing methods, extensions, and open challenges.

  25. The Hitchhiker's Guide to Agentic AI: From Foundations to Systems

    cs.AI 2026-06 unverdicted novelty 1.0 of 10

    A survey-style reference book mapping the full agentic-AI stack from transformer internals to production deployment, with no new research result.

Pith tools