Pith. sign in

REVIEW 12 cited by

Quantum Gravity Meets DESI: Dynamical Dark Energy in Light of the Trans-Planckian Censorship Conjecture

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2504.07791 v2 pith:VOAYQZXF submitted 2025-04-10 astro-ph.CO gr-qchep-phhep-th

classification astro-ph.COgr-qchep-phhep-th
keywords darkenergygravitydesidynamicalquantumtrans-planckianbehavior
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
abstract

Recent DESI DR2 observations indicate that dark energy has crossed from phantom to quintessence regime, a behavior known as the quintom-B realization. In this work we constrain dynamical dark energy and modified gravity using the swampland Trans-Planckian Censorship Conjecture (TCC), which forbids eternal acceleration since in this case any trans-Planckian quantum fluctuation would eventually stretch beyond the Hubble radius, breaking the applicability of any effective field theory and cosmological techniques. By combining DESI DR2 data with the TCC criterion, we impose tight constraints on the dark energy equation of state and its parameter space in scenarios such as the Chevallier-Polarski-Linder, Barboza-Alcaniz, Jassal-Bagla-Padmanabhan, EXP and LOG parameterizations, significantly constraining the quintom-A behavior. Also we examine models within the framework of $f(T)$ and $f(Q)$ modified gravity theories, demonstrating that TCC is very powerful to constrain or exclude them, a result that indicates the necessity to consider infrared modifications on General Relativity apart from the usual ultraviolet ones. Our findings imply that viable dynamical dark energy scenarios must asymptotically transit to deceleration, shedding light on new physics consistent with both cosmological observations and quantum gravity principles.

Discussion (0). Sign in to comment.

Forward citations

Cited by 12 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Uncalibrated Cosmic Standards as a Robust Test on Late-Time Cosmological Models

    astro-ph.CO 2025-06 conditional novelty 6.0 of 10

    Using uncalibrated distances, constraints on dynamic dark energy shift toward ΛCDM, and a fitted supernova magnitude bias removes the remaining tension.

  2. Background-level reconstruction of scalar-field potentials from dark-energy histories and comparison with analytic potential families

    astro-ph.CO 2026-03 conditional novelty 5.5 of 10

    A background reconstruction maps prescribed ρ_de(z) histories to V(φ) and ranks analytic potentials by Bayesian evidence, with exponential preferred for CPL and shifted-tanh for sign-switching targets.

  3. Revisiting cosmic acceleration with DESI BAO

    astro-ph.CO 2025-07 conditional novelty 5.0 of 10

    Constraints from DESI BAO, Planck CMB, and three SN catalogs yield a negative jerk parameter at z=0 in the CPL model, suggesting cosmic acceleration is slowing.

  4. Exploring non-cold dark matter in a scenario of dynamical dark energy with DESI DR2 data

    astro-ph.CO 2025-07 conditional novelty 5.0 of 10

    Using DESI DR2, Planck, and supernova data, a nonzero dark matter equation of state is preferred at 2.8 to 3.3 sigma only when dark energy is assumed to have a constant equation of state.

  5. Observational Constraints on Scalar Field--Matter Interaction in Weyl Integrable Spacetime

    gr-qc 2025-06 conditional novelty 5.0 of 10

    A Weyl Integrable Spacetime model with one extra parameter fits current late-time cosmological data slightly better than Lambda-CDM, with weak to moderate statistical preference.

  6. Neutrino mass constraints in the Schwarzschild-de Sitter black-hole dark energy model with ACT DR6 and DESI DR2 data

    astro-ph.CO 2026-07 conditional novelty 4.5 of 10

    SdSDE dark energy yields a ~0.16–0.21 eV positive neutrino-mass preference with DESI+ACT data, but χ² strongly favors extended ΛCDM and the shift is likely compensation.

  7. Observational constraints on the modified cosmology inspired by string T-duality

    gr-qc 2025-10 conditional novelty 4.0 of 10

    Late-time data bound the T-duality zero-point-length coupling to β ≲ 10^-3, leaving ΛCDM statistically equivalent.

  8. Alleviating the $H_0$ tension through the interacting dark energy model from quantum gravitational field theory in light of DESI DR2

    astro-ph.CO 2025-10 conditional novelty 4.0 of 10

    With DESI DR2 BAO plus CMB and a SH0ES prior, the two-parameter eeΛCDM model gives δΛ=-0.41±0.14 and H0=71.9±1.0, easing the Hubble tension to 0.8σ, but SN datasets erase the signal.

  9. Averaging Dynamics of Scalar Field-Matter Interacting Models in Anisotropic Universes: The Locally Rotationally Symmetric Bianchi I Spacetime

    gr-qc 2025-08 reject novelty 4.0 of 10

    The authors apply averaging methods to classify late-time attractors for nine interacting dark sector models in Bianchi I cosmology, but the general interaction formula does not match the specific models analyzed.

  10. Cosmological preference for a positive neutrino mass at 2.7$\sigma$: A joint analysis of DESI DR2, DESY5, and DESY1 data

    astro-ph.CO 2025-07 conditional novelty 4.0 of 10

    A joint fit of DESI DR2, CMB, DESY5 and DESY1 data gives total neutrino mass 0.098 (+0.016, -0.037) eV, a 2.7 sigma preference for positive mass in the w0waCDM model.

  11. Constraint on Symmetric Teleparallel Gravity with Different Dark energy Parametrizations from DESI DR2 BAO Data

    gr-qc 2025-07 reject novelty 4.0 of 10

    MCMC fits of CPL and BA dark energy parametrizations in power-law f(Q) gravity to DESI DR2 and prior BAO H(z) data find statistically competitive or better fits than Lambda-CDM.

  12. Topological defects as effective dynamical dark energy

    hep-ph 2025-06 conditional novelty 4.0 of 10

    A few percent domain-wall component gives a mild (Δχ² = -1.72) improvement over ΛCDM when fitting DESI DR2 BAO and DESY5 supernovae, but the evidence is inconclusive.

Pith tools