Pith. sign in

REVIEW 32 cited by

The Stack: 3 TB of permissively licensed source code

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2211.15533 v1 pith:WCJXKTDV submitted 2022-11-20 cs.CL cs.AI

The Stack: 3 TB of permissively licensed source code

classification cs.CL cs.AI
keywords codedatasetlicensedpermissivelystackdatahttpsbigcode
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Large Language Models (LLMs) play an ever-increasing role in the field of Artificial Intelligence (AI)--not only for natural language processing but also for code understanding and generation. To stimulate open and responsible research on LLMs for code, we introduce The Stack, a 3.1 TB dataset consisting of permissively licensed source code in 30 programming languages. We describe how we collect the full dataset, construct a permissively licensed subset, present a data governance plan, discuss limitations, and show promising results on text2code benchmarks by training 350M-parameter decoders on different Python subsets. We find that (1) near-deduplicating the data significantly boosts performance across all experiments, and (2) it is possible to match previously reported HumanEval and MBPP performance using only permissively licensed data. We make the dataset available at https://hf.co/BigCode, provide a tool called "Am I in The Stack" (https://hf.co/spaces/bigcode/in-the-stack) for developers to search The Stack for copies of their code, and provide a process for code to be removed from the dataset by following the instructions at https://www.bigcode-project.org/docs/about/the-stack/.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 32 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. LLM Translation of Compiler Intermediate Representation

    cs.PL 2026-05 unverdicted novelty 8.0

    IRIS-14B is the first LLM trained explicitly for GIMPLE-to-LLVM IR translation and outperforms much larger models by up to 44 percentage points on real-world C code.

  2. Through the Bottleneck: How Multi-head Latent Attention Separates Content from Position in Language Models

    cs.LG 2026-07 conditional novelty 7.0

    In a small MLA language model, the compressed KV cache carries content/entity information but little positional information, and all five induction heads appear in one layer.

  3. PrivCode++: Latent-Conditioned Differentially Private Code Generation for Comprehensive Guarantees

    cs.CR 2026-06 unverdicted novelty 7.0

    PrivCode++ introduces the first DP code generation method protecting both prompts and code via latent-conditioned two-stage training, claiming higher utility and stronger privacy than prior baselines.

  4. When LLMs Invent Rust Crates: An Empirical Study of Hallucination Patterns and Mitigation

    cs.SE 2026-06 unverdicted novelty 7.0

    First empirical study shows crate hallucination in Rust LLMs has consistent rates across models insensitive to parameters and tests prompt-based mitigation.

  5. 3DCodeBench: Benchmarking Agentic Procedural 3D Modeling Via Code

    cs.CV 2026-05 unverdicted novelty 7.0

    3DCodeBench is a new benchmark evaluating 12 VLMs on translating multimodal prompts into procedural 3D modeling code, paired with 3DCodeArena for human preference rankings.

  6. VISTA: An End-to-End Benchmark for Visual Spec-to-Web-App Coding Agents

    cs.SE 2026-05 unverdicted novelty 7.0

    VISTA is a new benchmark for end-to-end visual spec-to-web-app generation by LLM agents, featuring five prompt conditions, manual UI annotations, multi-metric evaluation, and results on four agent systems showing part...

  7. Provable Joint Decontamination for Benchmarking Multiple Large Language Models

    cs.LG 2026-05 unverdicted novelty 7.0

    JECS aggregates per-model conformal p-values via their maximum and reconstructs a conservative envelope of the max-p null distribution to select benchmarks with global contamination rate control.

  8. ClassEval-Pro: A Cross-Domain Benchmark for Class-Level Code Generation

    cs.SE 2026-04 unverdicted novelty 7.0

    ClassEval-Pro benchmark shows frontier LLMs achieve at most 45.6% Pass@1 on class-level code tasks, with logic errors (56%) and dependency errors (38%) as dominant failure modes.

  9. KernelBench: Can LLMs Write Efficient GPU Kernels?

    cs.LG 2025-02 accept novelty 7.0

    KernelBench shows that even the best current LLMs generate correct and faster-than-baseline GPU kernels in fewer than 20 percent of realistic ML workloads.

  10. RTLCurator: Label-Efficient Data Curation for RTL Generation

    cs.AR 2026-07 conditional novelty 6.0

    Keeping 80% of a synthetic RTL corpus selected by a behavior-aware alignment score plus coverage and structural balancing outperforms training on the full corpus, with only 10% of pairs validated.

  11. GVR-Coder: A Visual-Feedback Framework for Structured SVG Generation in Complex Document and Meeting Scenarios

    cs.LG 2026-07 conditional novelty 6.0

    A curriculum-plus-RL-plus-repair SVG agent, trained on a new 100K office-diagram dataset, beats strong LLM baselines on layout-correct logical diagrams from long professional text.

  12. SimulS2ST-Omni: Data-Efficient Streaming Speech-to-Speech Translation via Explicit Trajectory Supervision

    cs.SD 2026-07 conditional novelty 6.0

    A joint text-code trajectory supervision recipe lets a two-stream speech LM achieve competitive long-form streaming S2ST with ~2k hours of paired speech.

  13. EmbeddedKittens: An Evaluation of Code Embeddings for Scratch

    cs.SE 2026-07 conditional novelty 6.0

    Structure-aware embeddings such as GGNN transfer to Scratch and can support sprite naming and, with weaker evidence, correctness and progress prediction.

  14. Targeted Recovery of Weight-Space Mechanisms From Neural Networks

    cs.LG 2026-06 conditional novelty 6.0

    A targeted decomposition method recovers the weight-space mechanisms behind specific inputs at low FLOPs, enabling focused ablation and rewiring of a 12-block transformer.

  15. BlueFin: Benchmarking LLM Agents on Financial Spreadsheets

    cs.SE 2026-05 unverdicted novelty 6.0

    BlueFin is a new benchmark for LLM agents on financial spreadsheets showing frontier models score below 50% with weaknesses in dynamic correctness.

  16. Training Long-Context Vision-Language Models Effectively with Generalization Beyond 128K Context

    cs.CV 2026-05 unverdicted novelty 6.0

    Continued pre-training with balanced long-document VQA data extends a 7B LVLM to 128K context, improving long-document VQA by 7.1% and generalizing to 512K without further training.

  17. From Token Lists to Graph Motifs: Weisfeiler-Lehman Analysis of Sparse Autoencoder Features

    cs.AI 2026-05 conditional novelty 6.0

    Graph-motif clustering of SAE features via a frequency-binned WL kernel recovers structural families not captured by decoder cosine similarity or token histograms.

  18. Compute Optimal Tokenization

    cs.CL 2026-05 unverdicted novelty 6.0

    Compute-optimal language models require parameter count to scale with data bytes rather than tokens, with optimal token compression rate decreasing as compute budget grows.

  19. Compute Optimal Tokenization

    cs.CL 2026-05 unverdicted novelty 6.0

    In compute-optimal regimes, language model parameter count scales proportionally with data bytes rather than tokens, and the optimal compression rate decreases with increasing compute.

  20. A Taxonomy of Programming Languages for Code Generation

    cs.CL 2026-03 accept novelty 6.0

    The researchers provide a systematic 4-tier classification of 646 programming languages, quantifying the extreme data scarcity facing over 70% of the world's programming languages in the age of LLMs.

  21. SmolVLM: Redefining small and efficient multimodal models

    cs.AI 2025-04 unverdicted novelty 6.0

    SmolVLM-256M outperforms a 300-times larger model using under 1 GB GPU memory, while the 2.2B version matches state-of-the-art VLMs at half the memory cost.

  22. Textbooks Are All You Need II: phi-1.5 technical report

    cs.CL 2023-09 unverdicted novelty 6.0

    phi-1.5 is a 1.3B parameter model trained on synthetic textbook data that matches the reasoning performance of models five times larger on natural language, math, and basic coding tasks.

  23. Textbooks Are All You Need

    cs.CL 2023-06 unverdicted novelty 6.0

    A 1.3B-parameter code model trained on 7B tokens of curated textbook and synthetic data achieves 50.6% on HumanEval, indicating data quality can enable strong performance at small scale.

  24. Scaling Data-Constrained Language Models

    cs.CL 2023-05 conditional novelty 6.0

    Repeating training data up to 4 epochs yields negligible loss increase versus unique data for fixed compute, and a new scaling law accounts for the decaying value of repeated tokens and excess parameters.

  25. Bash-Commenter: Leveraging Syntax-Aware Preference Optimization to Reinforce Large Language Model for Bash Code Comment Generation

    cs.SE 2026-06 unverdicted novelty 5.0

    Bash-Commenter applies CPT, SFT, and Syntax-Aware Preference Optimization (SAPO) via AST atomic operations to LLaMA-3.1-8B, reporting higher BLEU-4/METEOR/ROUGE-L scores than baselines on single-line and multi-line Ba...

  26. On Fixing Insecure AI-Generated Code through Model Fine-Tuning and Prompting Strategies

    cs.SE 2026-05 unverdicted novelty 5.0

    Fine-tuning and prompting reduce some CWEs in AI-generated code but frequently introduce new weaknesses, with no strategy working reliably across models or languages.

  27. Malicious and Unintentional Disclosure Risks in Large Language Models for Code Generation

    cs.CR 2025-03 unverdicted novelty 5.0

    The study decomposes memorization risks in code LLMs into unintentional and malicious disclosure, demonstrates assessment methods on OLMo models and Dolma data, and finds that data changes affect risks differently dep...

  28. SmolLM2: When Smol Goes Big -- Data-Centric Training of a Small Language Model

    cs.CL 2025-02 unverdicted novelty 5.0

    SmolLM2 is a 1.7B-parameter language model that outperforms Qwen2.5-1.5B and Llama3.2-1B after overtraining on 11 trillion tokens using custom FineMath, Stack-Edu, and SmolTalk datasets in a multi-stage pipeline.

  29. StarCoder: may the source be with you!

    cs.CL 2023-05 accept novelty 5.0

    StarCoderBase matches or beats OpenAI's code-cushman-001 on multi-language code benchmarks; the Python-fine-tuned StarCoder reaches 40% pass@1 on HumanEval while retaining other-language performance.

  30. Reward-Free Code Alignment from Pretrained or Fine-Tuned LLM: Unpacking the Trade-offs for Code Generation

    cs.SE 2026-06 unverdicted novelty 4.0

    Empirical study on five LLMs finds pretrained-to-aligned paths yield bigger gains over baseline than finetuned-to-aligned paths, though absolute accuracy remains lower for pretrained starts.

  31. Context-Instrumental Data Distillation for Kubernetes Manifest Generation: Method and Experimental Evaluation

    cs.LG 2026-05 unverdicted novelty 4.0

    Context-instrumental data distillation allows a 1.5B SLM to generate valid Kubernetes manifests at 91.5% pass@1 rate, with strict output formatting proving more impactful than additional training data.

  32. A Survey of Large Language Models

    cs.CL 2023-03 accept novelty 3.0

    This survey reviews the background, key techniques, and evaluation methods for large language models, emphasizing emergent abilities that appear at large scales.